From 55d52fd5c35351c221f055ab08f3855ab5782b0d Mon Sep 17 00:00:00 2001 From: Jordan Liggitt Date: Fri, 5 Apr 2019 11:18:45 -0400 Subject: [PATCH] golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db (release-branch.go1.12) --- go.mod | 2 +- go.sum | 4 +- staging/src/k8s.io/api/go.mod | 3 +- staging/src/k8s.io/api/go.sum | 5 +- .../src/k8s.io/apiextensions-apiserver/go.mod | 2 +- .../src/k8s.io/apiextensions-apiserver/go.sum | 4 +- staging/src/k8s.io/apimachinery/go.mod | 4 +- staging/src/k8s.io/apimachinery/go.sum | 5 +- staging/src/k8s.io/apiserver/go.mod | 3 +- staging/src/k8s.io/apiserver/go.sum | 5 +- staging/src/k8s.io/cli-runtime/go.mod | 5 +- staging/src/k8s.io/cli-runtime/go.sum | 5 +- staging/src/k8s.io/client-go/go.mod | 3 +- staging/src/k8s.io/client-go/go.sum | 5 +- staging/src/k8s.io/cloud-provider/go.mod | 3 +- staging/src/k8s.io/cloud-provider/go.sum | 5 +- staging/src/k8s.io/cluster-bootstrap/go.mod | 3 +- staging/src/k8s.io/cluster-bootstrap/go.sum | 5 +- staging/src/k8s.io/component-base/go.mod | 3 +- staging/src/k8s.io/component-base/go.sum | 5 +- staging/src/k8s.io/cri-api/go.mod | 5 +- staging/src/k8s.io/cri-api/go.sum | 5 +- staging/src/k8s.io/csi-translation-lib/go.mod | 3 +- staging/src/k8s.io/csi-translation-lib/go.sum | 5 +- staging/src/k8s.io/kube-aggregator/go.mod | 2 +- staging/src/k8s.io/kube-aggregator/go.sum | 4 +- .../src/k8s.io/kube-controller-manager/go.mod | 3 +- .../src/k8s.io/kube-controller-manager/go.sum | 5 +- staging/src/k8s.io/kube-proxy/go.mod | 3 +- staging/src/k8s.io/kube-proxy/go.sum | 5 +- staging/src/k8s.io/kube-scheduler/go.mod | 3 +- staging/src/k8s.io/kube-scheduler/go.sum | 5 +- staging/src/k8s.io/kubelet/go.mod | 3 +- staging/src/k8s.io/kubelet/go.sum | 5 +- staging/src/k8s.io/metrics/go.mod | 2 +- staging/src/k8s.io/metrics/go.sum | 4 +- staging/src/k8s.io/node-api/go.mod | 2 +- staging/src/k8s.io/node-api/go.sum | 4 +- staging/src/k8s.io/sample-apiserver/go.mod | 2 +- staging/src/k8s.io/sample-apiserver/go.sum | 4 +- staging/src/k8s.io/sample-cli-plugin/go.mod | 3 +- staging/src/k8s.io/sample-cli-plugin/go.sum | 5 +- staging/src/k8s.io/sample-controller/go.mod | 2 +- staging/src/k8s.io/sample-controller/go.sum | 4 +- vendor/BUILD | 1 + vendor/golang.org/x/text/encoding/encoding.go | 2 +- .../x/text/encoding/htmlindex/htmlindex.go | 2 +- .../x/text/encoding/htmlindex/tables.go | 1 + .../internal/identifier/identifier.go | 2 +- .../text/encoding/internal/identifier/mib.go | 10 +- .../x/text/encoding/japanese/maketables.go | 4 +- .../x/text/encoding/unicode/unicode.go | 2 +- .../golang.org/x/text/internal/language/BUILD | 38 + .../x/text/{ => internal}/language/common.go | 12 +- .../x/text/internal/language/compact.go | 29 + .../x/text/internal/language/compact/BUILD | 30 + .../text/internal/language/compact/compact.go | 61 + .../x/text/internal/language/compact/gen.go | 64 + .../internal/language/compact/gen_index.go | 113 + .../internal/language/compact/gen_parents.go | 54 + .../internal/language/compact/language.go | 260 + .../text/internal/language/compact/parents.go | 120 + .../text/internal/language/compact/tables.go | 1015 +++ .../x/text/internal/language/compact/tags.go | 91 + .../x/text/internal/language/compose.go | 167 + .../x/text/internal/language/coverage.go | 28 + .../x/text/internal/language/gen.go | 1520 ++++ .../{ => internal}/language/gen_common.go | 12 +- .../x/text/internal/language/language.go | 596 ++ .../x/text/{ => internal}/language/lookup.go | 120 +- .../x/text/internal/language/match.go | 226 + .../x/text/internal/language/parse.go | 594 ++ .../x/text/internal/language/tables.go | 3431 ++++++++ .../x/text/internal/language/tags.go | 48 + vendor/golang.org/x/text/language/BUILD | 9 +- vendor/golang.org/x/text/language/Makefile | 16 - vendor/golang.org/x/text/language/coverage.go | 34 +- vendor/golang.org/x/text/language/doc.go | 102 + vendor/golang.org/x/text/language/gen.go | 1548 +--- .../golang.org/x/text/language/gen_index.go | 162 - vendor/golang.org/x/text/language/index.go | 769 -- vendor/golang.org/x/text/language/language.go | 811 +- vendor/golang.org/x/text/language/match.go | 672 +- vendor/golang.org/x/text/language/parse.go | 737 +- vendor/golang.org/x/text/language/tables.go | 3828 +------- vendor/golang.org/x/text/language/tags.go | 160 +- .../golang.org/x/text/secure/bidirule/BUILD | 6 +- .../x/text/secure/bidirule/bidirule.go | 8 +- .../x/text/secure/bidirule/bidirule10.0.0.go | 11 + .../x/text/secure/bidirule/bidirule9.0.0.go | 14 + .../golang.org/x/text/transform/transform.go | 4 +- vendor/golang.org/x/text/unicode/bidi/BUILD | 3 +- vendor/golang.org/x/text/unicode/bidi/bidi.go | 2 +- .../golang.org/x/text/unicode/bidi/bracket.go | 4 +- vendor/golang.org/x/text/unicode/bidi/core.go | 2 +- vendor/golang.org/x/text/unicode/bidi/gen.go | 4 +- .../x/text/unicode/bidi/gen_ranges.go | 2 +- .../x/text/unicode/bidi/tables10.0.0.go | 1815 ++++ .../bidi/{tables.go => tables9.0.0.go} | 2 + vendor/golang.org/x/text/unicode/norm/BUILD | 3 +- .../x/text/unicode/norm/composition.go | 8 +- .../x/text/unicode/norm/forminfo.go | 19 + vendor/golang.org/x/text/unicode/norm/iter.go | 3 +- .../x/text/unicode/norm/maketables.go | 24 +- .../x/text/unicode/norm/normalize.go | 4 +- .../x/text/unicode/norm/readwriter.go | 4 +- .../x/text/unicode/norm/tables10.0.0.go | 7657 +++++++++++++++++ .../norm/{tables.go => tables9.0.0.go} | 1892 ++-- .../x/text/unicode/norm/transform.go | 12 +- vendor/golang.org/x/text/width/BUILD | 3 +- vendor/golang.org/x/text/width/gen.go | 2 +- vendor/golang.org/x/text/width/kind_string.go | 4 +- .../golang.org/x/text/width/tables10.0.0.go | 1318 +++ .../text/width/{tables.go => tables9.0.0.go} | 2 + vendor/golang.org/x/text/width/width.go | 6 +- vendor/modules.txt | 4 +- 116 files changed, 21547 insertions(+), 8963 deletions(-) create mode 100644 vendor/golang.org/x/text/internal/language/BUILD rename vendor/golang.org/x/text/{ => internal}/language/common.go (50%) create mode 100644 vendor/golang.org/x/text/internal/language/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/BUILD create mode 100644 vendor/golang.org/x/text/internal/language/compact/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/gen.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/gen_index.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/gen_parents.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/language.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/parents.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tags.go create mode 100644 vendor/golang.org/x/text/internal/language/compose.go create mode 100644 vendor/golang.org/x/text/internal/language/coverage.go create mode 100644 vendor/golang.org/x/text/internal/language/gen.go rename vendor/golang.org/x/text/{ => internal}/language/gen_common.go (60%) create mode 100644 vendor/golang.org/x/text/internal/language/language.go rename vendor/golang.org/x/text/{ => internal}/language/lookup.go (80%) create mode 100644 vendor/golang.org/x/text/internal/language/match.go create mode 100644 vendor/golang.org/x/text/internal/language/parse.go create mode 100644 vendor/golang.org/x/text/internal/language/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/tags.go delete mode 100644 vendor/golang.org/x/text/language/Makefile create mode 100644 vendor/golang.org/x/text/language/doc.go delete mode 100644 vendor/golang.org/x/text/language/gen_index.go delete mode 100644 vendor/golang.org/x/text/language/index.go create mode 100644 vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go create mode 100644 vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go create mode 100644 vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go rename vendor/golang.org/x/text/unicode/bidi/{tables.go => tables9.0.0.go} (99%) create mode 100644 vendor/golang.org/x/text/unicode/norm/tables10.0.0.go rename vendor/golang.org/x/text/unicode/norm/{tables.go => tables9.0.0.go} (85%) create mode 100644 vendor/golang.org/x/text/width/tables10.0.0.go rename vendor/golang.org/x/text/width/{tables.go => tables9.0.0.go} (99%) diff --git a/go.mod b/go.mod index b5e8c9bd62..331283aa50 100644 --- a/go.mod +++ b/go.mod @@ -439,7 +439,7 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gonum.org/v1/gonum => gonum.org/v1/gonum v0.0.0-20190331200053-3d26580ed485 diff --git a/go.sum b/go.sum index ad5bc5653a..37cf86715c 100644 --- a/go.sum +++ b/go.sum @@ -448,8 +448,8 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd h1:Es0jGqKF2dQq+Z+0JvLFrUgmuMpgFwsFnKJQiaKEJNU= diff --git a/staging/src/k8s.io/api/go.mod b/staging/src/k8s.io/api/go.mod index 9181eb6228..6caeafb134 100644 --- a/staging/src/k8s.io/api/go.mod +++ b/staging/src/k8s.io/api/go.mod @@ -36,7 +36,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/api/go.sum b/staging/src/k8s.io/api/go.sum index 4db71bffd1..9d45ed7355 100644 --- a/staging/src/k8s.io/api/go.sum +++ b/staging/src/k8s.io/api/go.sum @@ -35,8 +35,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73r golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTmV7VDcZyvRZ+QQXkXTZQ= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/apiextensions-apiserver/go.mod b/staging/src/k8s.io/apiextensions-apiserver/go.mod index 42104cf1e2..6a111568bf 100644 --- a/staging/src/k8s.io/apiextensions-apiserver/go.mod +++ b/staging/src/k8s.io/apiextensions-apiserver/go.mod @@ -146,7 +146,7 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gonum.org/v1/gonum => gonum.org/v1/gonum v0.0.0-20190331200053-3d26580ed485 diff --git a/staging/src/k8s.io/apiextensions-apiserver/go.sum b/staging/src/k8s.io/apiextensions-apiserver/go.sum index 01dc22eb43..3990b6b237 100644 --- a/staging/src/k8s.io/apiextensions-apiserver/go.sum +++ b/staging/src/k8s.io/apiextensions-apiserver/go.sum @@ -186,8 +186,8 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd h1:Es0jGqKF2dQq+Z+0JvLFrUgmuMpgFwsFnKJQiaKEJNU= diff --git a/staging/src/k8s.io/apimachinery/go.mod b/staging/src/k8s.io/apimachinery/go.mod index 1d9c63cf06..cb56f73c93 100644 --- a/staging/src/k8s.io/apimachinery/go.mod +++ b/staging/src/k8s.io/apimachinery/go.mod @@ -27,6 +27,7 @@ require ( golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync v0.0.0-20181108010431-42b317875d0f // indirect golang.org/x/sys v0.0.0-20181116152217-5ac8a444bdc5 // indirect + golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db // indirect gopkg.in/inf.v0 v0.9.0 gopkg.in/yaml.v2 v2.2.1 k8s.io/klog v0.0.0-20190306015804-8e90cee79f82 @@ -60,7 +61,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/apimachinery/go.sum b/staging/src/k8s.io/apimachinery/go.sum index 4b62c4f6cc..2bc080e03d 100644 --- a/staging/src/k8s.io/apimachinery/go.sum +++ b/staging/src/k8s.io/apimachinery/go.sum @@ -46,8 +46,9 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/apiserver/go.mod b/staging/src/k8s.io/apiserver/go.mod index 1331225d5a..ac862d1327 100644 --- a/staging/src/k8s.io/apiserver/go.mod +++ b/staging/src/k8s.io/apiserver/go.mod @@ -168,8 +168,9 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd google.golang.org/appengine => google.golang.org/appengine v1.5.0 google.golang.org/genproto => google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6 google.golang.org/grpc => google.golang.org/grpc v1.13.0 diff --git a/staging/src/k8s.io/apiserver/go.sum b/staging/src/k8s.io/apiserver/go.sum index 859a5964a3..2d293ae715 100644 --- a/staging/src/k8s.io/apiserver/go.sum +++ b/staging/src/k8s.io/apiserver/go.sum @@ -167,10 +167,11 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= google.golang.org/appengine v1.5.0 h1:KxkO13IPW4Lslp2bz+KHP2E3gtFlrIGNThxkZQ3g+4c= google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6 h1:72GtwBPfq6av9X0Ru2HtAopsPW+d+vh1K1zaxanTdE8= diff --git a/staging/src/k8s.io/cli-runtime/go.mod b/staging/src/k8s.io/cli-runtime/go.mod index 68f2d3afbc..735365968c 100644 --- a/staging/src/k8s.io/cli-runtime/go.mod +++ b/staging/src/k8s.io/cli-runtime/go.mod @@ -18,7 +18,7 @@ require ( github.com/spf13/cobra v0.0.0-20180319062004-c439c4fa0937 github.com/spf13/pflag v1.0.1 github.com/stretchr/testify v1.2.2 - golang.org/x/text v0.3.0 + golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db k8s.io/api v0.0.0 k8s.io/apimachinery v0.0.0 k8s.io/client-go v0.0.0 @@ -74,8 +74,9 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd google.golang.org/appengine => google.golang.org/appengine v1.5.0 gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 diff --git a/staging/src/k8s.io/cli-runtime/go.sum b/staging/src/k8s.io/cli-runtime/go.sum index bd3877d3d0..addc21daf7 100644 --- a/staging/src/k8s.io/cli-runtime/go.sum +++ b/staging/src/k8s.io/cli-runtime/go.sum @@ -80,10 +80,11 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= google.golang.org/appengine v1.5.0 h1:KxkO13IPW4Lslp2bz+KHP2E3gtFlrIGNThxkZQ3g+4c= google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= diff --git a/staging/src/k8s.io/client-go/go.mod b/staging/src/k8s.io/client-go/go.mod index 45b5c80216..1d975c0189 100644 --- a/staging/src/k8s.io/client-go/go.mod +++ b/staging/src/k8s.io/client-go/go.mod @@ -70,8 +70,9 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd google.golang.org/appengine => google.golang.org/appengine v1.5.0 gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 diff --git a/staging/src/k8s.io/client-go/go.sum b/staging/src/k8s.io/client-go/go.sum index e98eae8679..3a21fc7227 100644 --- a/staging/src/k8s.io/client-go/go.sum +++ b/staging/src/k8s.io/client-go/go.sum @@ -64,10 +64,11 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= google.golang.org/appengine v1.5.0 h1:KxkO13IPW4Lslp2bz+KHP2E3gtFlrIGNThxkZQ3g+4c= google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= diff --git a/staging/src/k8s.io/cloud-provider/go.mod b/staging/src/k8s.io/cloud-provider/go.mod index 8376c09c49..609e7ab942 100644 --- a/staging/src/k8s.io/cloud-provider/go.mod +++ b/staging/src/k8s.io/cloud-provider/go.mod @@ -108,8 +108,9 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd google.golang.org/appengine => google.golang.org/appengine v1.5.0 google.golang.org/genproto => google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6 google.golang.org/grpc => google.golang.org/grpc v1.13.0 diff --git a/staging/src/k8s.io/cloud-provider/go.sum b/staging/src/k8s.io/cloud-provider/go.sum index 9357f82169..f63dd95bfb 100644 --- a/staging/src/k8s.io/cloud-provider/go.sum +++ b/staging/src/k8s.io/cloud-provider/go.sum @@ -112,10 +112,11 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= google.golang.org/appengine v1.5.0 h1:KxkO13IPW4Lslp2bz+KHP2E3gtFlrIGNThxkZQ3g+4c= google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6/go.mod h1:JiN7NxoALGmiZfu7CAH4rXhgtRTLTxftemlI0sWmxmc= diff --git a/staging/src/k8s.io/cluster-bootstrap/go.mod b/staging/src/k8s.io/cluster-bootstrap/go.mod index 7cb20614d3..bcb2d6d22c 100644 --- a/staging/src/k8s.io/cluster-bootstrap/go.mod +++ b/staging/src/k8s.io/cluster-bootstrap/go.mod @@ -35,7 +35,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/cluster-bootstrap/go.sum b/staging/src/k8s.io/cluster-bootstrap/go.sum index 19f2bd6e5c..e68234686f 100644 --- a/staging/src/k8s.io/cluster-bootstrap/go.sum +++ b/staging/src/k8s.io/cluster-bootstrap/go.sum @@ -33,8 +33,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 h1:bfLnR+k0tq5Lqt6dflRLcZiz6 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/component-base/go.mod b/staging/src/k8s.io/component-base/go.mod index 411067603d..d599cd3834 100644 --- a/staging/src/k8s.io/component-base/go.mod +++ b/staging/src/k8s.io/component-base/go.mod @@ -37,7 +37,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/component-base/go.sum b/staging/src/k8s.io/component-base/go.sum index f32243501a..954fb57def 100644 --- a/staging/src/k8s.io/component-base/go.sum +++ b/staging/src/k8s.io/component-base/go.sum @@ -33,8 +33,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 h1:bfLnR+k0tq5Lqt6dflRLcZiz6 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/cri-api/go.mod b/staging/src/k8s.io/cri-api/go.mod index 4040205d66..8610cc3c1b 100644 --- a/staging/src/k8s.io/cri-api/go.mod +++ b/staging/src/k8s.io/cri-api/go.mod @@ -13,7 +13,7 @@ require ( github.com/stretchr/testify v1.2.2 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync v0.0.0-20181108010431-42b317875d0f // indirect - golang.org/x/text v0.3.0 // indirect + golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db // indirect google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6 // indirect google.golang.org/grpc v1.13.0 ) @@ -27,7 +27,8 @@ replace ( github.com/stretchr/testify => github.com/stretchr/testify v1.2.2 golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd google.golang.org/genproto => google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6 google.golang.org/grpc => google.golang.org/grpc v1.13.0 k8s.io/api => ../api diff --git a/staging/src/k8s.io/cri-api/go.sum b/staging/src/k8s.io/cri-api/go.sum index b69784779e..d2d1e41806 100644 --- a/staging/src/k8s.io/cri-api/go.sum +++ b/staging/src/k8s.io/cri-api/go.sum @@ -14,8 +14,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 h1:bfLnR+k0tq5Lqt6dflRLcZiz6 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTmV7VDcZyvRZ+QQXkXTZQ= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6 h1:72GtwBPfq6av9X0Ru2HtAopsPW+d+vh1K1zaxanTdE8= google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6/go.mod h1:JiN7NxoALGmiZfu7CAH4rXhgtRTLTxftemlI0sWmxmc= google.golang.org/grpc v1.13.0 h1:bHIbVsCwmvbArgCJmLdgOdHFXlKqTOVjbibbS19cXHc= diff --git a/staging/src/k8s.io/csi-translation-lib/go.mod b/staging/src/k8s.io/csi-translation-lib/go.mod index 5facb0932d..c9ae3c6059 100644 --- a/staging/src/k8s.io/csi-translation-lib/go.mod +++ b/staging/src/k8s.io/csi-translation-lib/go.mod @@ -105,8 +105,9 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd google.golang.org/appengine => google.golang.org/appengine v1.5.0 google.golang.org/genproto => google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6 google.golang.org/grpc => google.golang.org/grpc v1.13.0 diff --git a/staging/src/k8s.io/csi-translation-lib/go.sum b/staging/src/k8s.io/csi-translation-lib/go.sum index 9efae8adec..0c09cc86f8 100644 --- a/staging/src/k8s.io/csi-translation-lib/go.sum +++ b/staging/src/k8s.io/csi-translation-lib/go.sum @@ -102,9 +102,10 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73r golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= google.golang.org/genproto v0.0.0-20170731182057-09f6ed296fc6/go.mod h1:JiN7NxoALGmiZfu7CAH4rXhgtRTLTxftemlI0sWmxmc= google.golang.org/grpc v1.13.0/go.mod h1:yo6s7OP7yaDglbqo1J04qKzAhqBH6lvTonzMVmEdcZw= diff --git a/staging/src/k8s.io/kube-aggregator/go.mod b/staging/src/k8s.io/kube-aggregator/go.mod index ec8c67c6aa..8e994240a9 100644 --- a/staging/src/k8s.io/kube-aggregator/go.mod +++ b/staging/src/k8s.io/kube-aggregator/go.mod @@ -125,7 +125,7 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gonum.org/v1/gonum => gonum.org/v1/gonum v0.0.0-20190331200053-3d26580ed485 diff --git a/staging/src/k8s.io/kube-aggregator/go.sum b/staging/src/k8s.io/kube-aggregator/go.sum index 3d953c3c63..ac0b8001e3 100644 --- a/staging/src/k8s.io/kube-aggregator/go.sum +++ b/staging/src/k8s.io/kube-aggregator/go.sum @@ -170,8 +170,8 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd h1:Es0jGqKF2dQq+Z+0JvLFrUgmuMpgFwsFnKJQiaKEJNU= diff --git a/staging/src/k8s.io/kube-controller-manager/go.mod b/staging/src/k8s.io/kube-controller-manager/go.mod index 0e1e909d87..815979312b 100644 --- a/staging/src/k8s.io/kube-controller-manager/go.mod +++ b/staging/src/k8s.io/kube-controller-manager/go.mod @@ -35,7 +35,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/kube-controller-manager/go.sum b/staging/src/k8s.io/kube-controller-manager/go.sum index f32243501a..954fb57def 100644 --- a/staging/src/k8s.io/kube-controller-manager/go.sum +++ b/staging/src/k8s.io/kube-controller-manager/go.sum @@ -33,8 +33,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 h1:bfLnR+k0tq5Lqt6dflRLcZiz6 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/kube-proxy/go.mod b/staging/src/k8s.io/kube-proxy/go.mod index 103d7d7a1c..a512f0010c 100644 --- a/staging/src/k8s.io/kube-proxy/go.mod +++ b/staging/src/k8s.io/kube-proxy/go.mod @@ -35,7 +35,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/kube-proxy/go.sum b/staging/src/k8s.io/kube-proxy/go.sum index f32243501a..954fb57def 100644 --- a/staging/src/k8s.io/kube-proxy/go.sum +++ b/staging/src/k8s.io/kube-proxy/go.sum @@ -33,8 +33,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 h1:bfLnR+k0tq5Lqt6dflRLcZiz6 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/kube-scheduler/go.mod b/staging/src/k8s.io/kube-scheduler/go.mod index 8a8b22291e..af65e79f2b 100644 --- a/staging/src/k8s.io/kube-scheduler/go.mod +++ b/staging/src/k8s.io/kube-scheduler/go.mod @@ -35,7 +35,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/kube-scheduler/go.sum b/staging/src/k8s.io/kube-scheduler/go.sum index f32243501a..954fb57def 100644 --- a/staging/src/k8s.io/kube-scheduler/go.sum +++ b/staging/src/k8s.io/kube-scheduler/go.sum @@ -33,8 +33,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 h1:bfLnR+k0tq5Lqt6dflRLcZiz6 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/kubelet/go.mod b/staging/src/k8s.io/kubelet/go.mod index 637b8c498b..e0eec91ded 100644 --- a/staging/src/k8s.io/kubelet/go.mod +++ b/staging/src/k8s.io/kubelet/go.mod @@ -35,7 +35,8 @@ replace ( golang.org/x/net => golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 gopkg.in/inf.v0 => gopkg.in/inf.v0 v0.9.0 diff --git a/staging/src/k8s.io/kubelet/go.sum b/staging/src/k8s.io/kubelet/go.sum index 19f2bd6e5c..e68234686f 100644 --- a/staging/src/k8s.io/kubelet/go.sum +++ b/staging/src/k8s.io/kubelet/go.sum @@ -33,8 +33,9 @@ golang.org/x/net v0.0.0-20190206173232-65e2d4e15006 h1:bfLnR+k0tq5Lqt6dflRLcZiz6 golang.org/x/net v0.0.0-20190206173232-65e2d4e15006/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/fsnotify.v1 v1.4.7/go.mod h1:Tz8NjZHkW78fSQdbUxIjBTcgA1z1m8ZHf0WmKUhAMys= diff --git a/staging/src/k8s.io/metrics/go.mod b/staging/src/k8s.io/metrics/go.mod index 7c6f2104b7..a173af085a 100644 --- a/staging/src/k8s.io/metrics/go.mod +++ b/staging/src/k8s.io/metrics/go.mod @@ -51,7 +51,7 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gonum.org/v1/gonum => gonum.org/v1/gonum v0.0.0-20190331200053-3d26580ed485 diff --git a/staging/src/k8s.io/metrics/go.sum b/staging/src/k8s.io/metrics/go.sum index fc686b7db2..1283378437 100644 --- a/staging/src/k8s.io/metrics/go.sum +++ b/staging/src/k8s.io/metrics/go.sum @@ -54,8 +54,8 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd h1:Es0jGqKF2dQq+Z+0JvLFrUgmuMpgFwsFnKJQiaKEJNU= diff --git a/staging/src/k8s.io/node-api/go.mod b/staging/src/k8s.io/node-api/go.mod index dfa7c744fd..baf83fa5f8 100644 --- a/staging/src/k8s.io/node-api/go.mod +++ b/staging/src/k8s.io/node-api/go.mod @@ -48,7 +48,7 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gonum.org/v1/gonum => gonum.org/v1/gonum v0.0.0-20190331200053-3d26580ed485 diff --git a/staging/src/k8s.io/node-api/go.sum b/staging/src/k8s.io/node-api/go.sum index 0ac5d8389c..29ea7c46ad 100644 --- a/staging/src/k8s.io/node-api/go.sum +++ b/staging/src/k8s.io/node-api/go.sum @@ -56,8 +56,8 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd h1:Es0jGqKF2dQq+Z+0JvLFrUgmuMpgFwsFnKJQiaKEJNU= diff --git a/staging/src/k8s.io/sample-apiserver/go.mod b/staging/src/k8s.io/sample-apiserver/go.mod index e5c2ac5c2f..7c9eae2a5e 100644 --- a/staging/src/k8s.io/sample-apiserver/go.mod +++ b/staging/src/k8s.io/sample-apiserver/go.mod @@ -115,7 +115,7 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gonum.org/v1/gonum => gonum.org/v1/gonum v0.0.0-20190331200053-3d26580ed485 diff --git a/staging/src/k8s.io/sample-apiserver/go.sum b/staging/src/k8s.io/sample-apiserver/go.sum index 94a5ef024f..6ea5ce27a0 100644 --- a/staging/src/k8s.io/sample-apiserver/go.sum +++ b/staging/src/k8s.io/sample-apiserver/go.sum @@ -167,8 +167,8 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd h1:Es0jGqKF2dQq+Z+0JvLFrUgmuMpgFwsFnKJQiaKEJNU= diff --git a/staging/src/k8s.io/sample-cli-plugin/go.mod b/staging/src/k8s.io/sample-cli-plugin/go.mod index 0d776e8ecf..0fb2ceef4a 100644 --- a/staging/src/k8s.io/sample-cli-plugin/go.mod +++ b/staging/src/k8s.io/sample-cli-plugin/go.mod @@ -59,8 +59,9 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d + golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd google.golang.org/appengine => google.golang.org/appengine v1.5.0 gopkg.in/check.v1 => gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 gopkg.in/fsnotify.v1 => gopkg.in/fsnotify.v1 v1.4.7 diff --git a/staging/src/k8s.io/sample-cli-plugin/go.sum b/staging/src/k8s.io/sample-cli-plugin/go.sum index bd3877d3d0..addc21daf7 100644 --- a/staging/src/k8s.io/sample-cli-plugin/go.sum +++ b/staging/src/k8s.io/sample-cli-plugin/go.sum @@ -80,10 +80,11 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= google.golang.org/appengine v1.5.0 h1:KxkO13IPW4Lslp2bz+KHP2E3gtFlrIGNThxkZQ3g+4c= google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= diff --git a/staging/src/k8s.io/sample-controller/go.mod b/staging/src/k8s.io/sample-controller/go.mod index 3e75b998ae..ec966fae3b 100644 --- a/staging/src/k8s.io/sample-controller/go.mod +++ b/staging/src/k8s.io/sample-controller/go.mod @@ -50,7 +50,7 @@ replace ( golang.org/x/oauth2 => golang.org/x/oauth2 v0.0.0-20170412232759-a6bd8cefa181 golang.org/x/sync => golang.org/x/sync v0.0.0-20181108010431-42b317875d0f golang.org/x/sys => golang.org/x/sys v0.0.0-20171031081856-95c657629925 - golang.org/x/text => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 + golang.org/x/text => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/time => golang.org/x/time v0.0.0-20161028155119-f51c12702a4d golang.org/x/tools => golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd gonum.org/v1/gonum => gonum.org/v1/gonum v0.0.0-20190331200053-3d26580ed485 diff --git a/staging/src/k8s.io/sample-controller/go.sum b/staging/src/k8s.io/sample-controller/go.sum index c2058715dd..ac6512f27f 100644 --- a/staging/src/k8s.io/sample-controller/go.sum +++ b/staging/src/k8s.io/sample-controller/go.sum @@ -57,8 +57,8 @@ golang.org/x/sync v0.0.0-20181108010431-42b317875d0f h1:Bl/8QSvNqXvPGPGXa2z5xUTm golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20171031081856-95c657629925 h1:nCH33NboKIsT4HoXBsXTWX8ul303HxWgkc5s2Ezwacg= golang.org/x/sys v0.0.0-20171031081856-95c657629925/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317 h1:WKW+OPdYPlvOTVGHuMfjnIC6yY2SI93yFB0pZ7giBmQ= -golang.org/x/text v0.0.0-20170810154203-b19bf474d317/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d h1:TnM+PKb3ylGmZvyPXmo9m/wktg7Jn/a/fNmr33HSj8g= golang.org/x/time v0.0.0-20161028155119-f51c12702a4d/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20190205050122-7f7074d5bcfd h1:Es0jGqKF2dQq+Z+0JvLFrUgmuMpgFwsFnKJQiaKEJNU= diff --git a/vendor/BUILD b/vendor/BUILD index 8d8354db68..d0d27ab070 100644 --- a/vendor/BUILD +++ b/vendor/BUILD @@ -409,6 +409,7 @@ filegroup( "//vendor/golang.org/x/sys/unix:all-srcs", "//vendor/golang.org/x/sys/windows:all-srcs", "//vendor/golang.org/x/text/encoding:all-srcs", + "//vendor/golang.org/x/text/internal/language:all-srcs", "//vendor/golang.org/x/text/internal/tag:all-srcs", "//vendor/golang.org/x/text/internal/utf8internal:all-srcs", "//vendor/golang.org/x/text/language:all-srcs", diff --git a/vendor/golang.org/x/text/encoding/encoding.go b/vendor/golang.org/x/text/encoding/encoding.go index 221f175c01..a0bd7cd4d0 100644 --- a/vendor/golang.org/x/text/encoding/encoding.go +++ b/vendor/golang.org/x/text/encoding/encoding.go @@ -124,7 +124,7 @@ func (e *Encoder) Writer(w io.Writer) io.Writer { } // ASCIISub is the ASCII substitute character, as recommended by -// http://unicode.org/reports/tr36/#Text_Comparison +// https://unicode.org/reports/tr36/#Text_Comparison const ASCIISub = '\x1a' // Nop is the nop encoding. Its transformed bytes are the same as the source diff --git a/vendor/golang.org/x/text/encoding/htmlindex/htmlindex.go b/vendor/golang.org/x/text/encoding/htmlindex/htmlindex.go index 70f2ac4bc7..bdc7d15dda 100644 --- a/vendor/golang.org/x/text/encoding/htmlindex/htmlindex.go +++ b/vendor/golang.org/x/text/encoding/htmlindex/htmlindex.go @@ -50,7 +50,7 @@ func LanguageDefault(tag language.Tag) string { for _, t := range strings.Split(locales, " ") { tags = append(tags, language.MustParse(t)) } - matcher = language.NewMatcher(tags) + matcher = language.NewMatcher(tags, language.PreferSameScript(true)) }) _, i, _ := matcher.Match(tag) return canonical[localeMap[i]] // Default is Windows-1252. diff --git a/vendor/golang.org/x/text/encoding/htmlindex/tables.go b/vendor/golang.org/x/text/encoding/htmlindex/tables.go index 9d6b4315c2..f074e2c6da 100644 --- a/vendor/golang.org/x/text/encoding/htmlindex/tables.go +++ b/vendor/golang.org/x/text/encoding/htmlindex/tables.go @@ -306,6 +306,7 @@ var nameMap = map[string]htmlEncoding{ "iso-2022-cn": replacement, "iso-2022-cn-ext": replacement, "iso-2022-kr": replacement, + "replacement": replacement, "utf-16be": utf16be, "utf-16": utf16le, "utf-16le": utf16le, diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go index 7351b4ef8a..5c9b85c280 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go @@ -34,7 +34,7 @@ package identifier // - http://www.iana.org/assignments/character-sets/character-sets.xhtml // - http://www.iana.org/assignments/ianacharset-mib/ianacharset-mib // - http://www.ietf.org/rfc/rfc2978.txt -// - http://www.unicode.org/reports/tr22/ +// - https://www.unicode.org/reports/tr22/ // - http://www.w3.org/TR/encoding/ // - https://encoding.spec.whatwg.org/ // - https://encoding.spec.whatwg.org/encodings.json diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go index 768842b0a5..8cc29021c8 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go @@ -884,27 +884,27 @@ const ( // CESU8 is the MIB identifier with IANA name CESU-8. // - // http://www.unicode.org/unicode/reports/tr26 + // https://www.unicode.org/unicode/reports/tr26 CESU8 MIB = 1016 // UTF32 is the MIB identifier with IANA name UTF-32. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/unicode/reports/tr19/ UTF32 MIB = 1017 // UTF32BE is the MIB identifier with IANA name UTF-32BE. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/unicode/reports/tr19/ UTF32BE MIB = 1018 // UTF32LE is the MIB identifier with IANA name UTF-32LE. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/unicode/reports/tr19/ UTF32LE MIB = 1019 // BOCU1 is the MIB identifier with IANA name BOCU-1. // - // http://www.unicode.org/notes/tn6/ + // https://www.unicode.org/notes/tn6/ BOCU1 MIB = 1020 // Windows30Latin1 is the MIB identifier with IANA name ISO-8859-1-Windows-3.0-Latin-1. diff --git a/vendor/golang.org/x/text/encoding/japanese/maketables.go b/vendor/golang.org/x/text/encoding/japanese/maketables.go index d6c10deb07..023957a672 100644 --- a/vendor/golang.org/x/text/encoding/japanese/maketables.go +++ b/vendor/golang.org/x/text/encoding/japanese/maketables.go @@ -10,8 +10,8 @@ package main // go run maketables.go | gofmt > tables.go // TODO: Emoji extensions? -// http://www.unicode.org/faq/emoji_dingbats.html -// http://www.unicode.org/Public/UNIDATA/EmojiSources.txt +// https://www.unicode.org/faq/emoji_dingbats.html +// https://www.unicode.org/Public/UNIDATA/EmojiSources.txt import ( "bufio" diff --git a/vendor/golang.org/x/text/encoding/unicode/unicode.go b/vendor/golang.org/x/text/encoding/unicode/unicode.go index 579cadfb12..4850ff365b 100644 --- a/vendor/golang.org/x/text/encoding/unicode/unicode.go +++ b/vendor/golang.org/x/text/encoding/unicode/unicode.go @@ -145,7 +145,7 @@ func (utf8Decoder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err e // and consumed in a greater context that implies a certain endianness, use // IgnoreBOM. Otherwise, use ExpectBOM and always produce and consume a BOM. // -// In the language of http://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM +// In the language of https://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM // corresponds to "Where the precise type of the data stream is known... the // BOM should not be used" and ExpectBOM corresponds to "A particular // protocol... may require use of the BOM". diff --git a/vendor/golang.org/x/text/internal/language/BUILD b/vendor/golang.org/x/text/internal/language/BUILD new file mode 100644 index 0000000000..6a8fccdbee --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/BUILD @@ -0,0 +1,38 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = [ + "common.go", + "compact.go", + "compose.go", + "coverage.go", + "language.go", + "lookup.go", + "match.go", + "parse.go", + "tables.go", + "tags.go", + ], + importmap = "k8s.io/kubernetes/vendor/golang.org/x/text/internal/language", + importpath = "golang.org/x/text/internal/language", + visibility = ["//vendor/golang.org/x/text:__subpackages__"], + deps = ["//vendor/golang.org/x/text/internal/tag:go_default_library"], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [ + ":package-srcs", + "//vendor/golang.org/x/text/internal/language/compact:all-srcs", + ], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/internal/language/common.go similarity index 50% rename from vendor/golang.org/x/text/language/common.go rename to vendor/golang.org/x/text/internal/language/common.go index 9d86e18554..cdfdb74971 100644 --- a/vendor/golang.org/x/text/language/common.go +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -4,13 +4,13 @@ package language // This file contains code common to the maketables.go and the package code. -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 +// AliasType is the type of an alias in AliasMap. +type AliasType int8 const ( - langDeprecated langAliasType = iota - langMacro - langLegacy + Deprecated AliasType = iota + Macro + Legacy - langAliasTypeUnknown langAliasType = -1 + AliasTypeUnknown AliasType = -1 ) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 0000000000..46a0015074 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/BUILD b/vendor/golang.org/x/text/internal/language/compact/BUILD new file mode 100644 index 0000000000..83a8edd0e0 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/BUILD @@ -0,0 +1,30 @@ +load("@io_bazel_rules_go//go:def.bzl", "go_library") + +go_library( + name = "go_default_library", + srcs = [ + "compact.go", + "language.go", + "parents.go", + "tables.go", + "tags.go", + ], + importmap = "k8s.io/kubernetes/vendor/golang.org/x/text/internal/language/compact", + importpath = "golang.org/x/text/internal/language/compact", + visibility = ["//vendor/golang.org/x/text:__subpackages__"], + deps = ["//vendor/golang.org/x/text/internal/language:go_default_library"], +) + +filegroup( + name = "package-srcs", + srcs = glob(["**"]), + tags = ["automanaged"], + visibility = ["//visibility:private"], +) + +filegroup( + name = "all-srcs", + srcs = [":package-srcs"], + tags = ["automanaged"], + visibility = ["//visibility:public"], +) diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000000..1b36935ef7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go new file mode 100644 index 0000000000..0c36a052f6 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/gen.go @@ -0,0 +1,64 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// Language tag table generator. +// Data read from the web. + +package main + +import ( + "flag" + "fmt" + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", + false, + "test existing tables; can be used to compare web data with package data.") + outputFile = flag.String("output", + "tables.go", + "output file for generated tables") +) + +func main() { + gen.Init() + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "compact") + + fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`) + + b := newBuilder(w) + gen.WriteCLDRVersion(w) + + b.writeCompactIndex() +} + +type builder struct { + w *gen.CodeWriter + data *cldr.CLDR + supp *cldr.SupplementalData +} + +func newBuilder(w *gen.CodeWriter) *builder { + r := gen.OpenCLDRCoreZip() + defer r.Close() + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatal(err) + } + b := builder{ + w: w, + data: data, + supp: data.Supplemental(), + } + return &b +} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go new file mode 100644 index 0000000000..136cefaf08 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/gen_index.go @@ -0,0 +1,113 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// This file generates derivative tables based on the language package itself. + +import ( + "fmt" + "log" + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// Compact indices: +// Note -va-X variants only apply to localization variants. +// BCP variants only ever apply to language. +// The only ambiguity between tags is with regions. + +func (b *builder) writeCompactIndex() { + // Collect all language tags for which we have any data in CLDR. + m := map[language.Tag]bool{} + for _, lang := range b.data.Locales() { + // We include all locales unconditionally to be consistent with en_US. + // We want en_US, even though it has no data associated with it. + + // TODO: put any of the languages for which no data exists at the end + // of the index. This allows all components based on ICU to use that + // as the cutoff point. + // if x := data.RawLDML(lang); false || + // x.LocaleDisplayNames != nil || + // x.Characters != nil || + // x.Delimiters != nil || + // x.Measurement != nil || + // x.Dates != nil || + // x.Numbers != nil || + // x.Units != nil || + // x.ListPatterns != nil || + // x.Collations != nil || + // x.Segmentations != nil || + // x.Rbnf != nil || + // x.Annotations != nil || + // x.Metadata != nil { + + // TODO: support POSIX natively, albeit non-standard. + tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) + m[tag] = true + // } + } + + // TODO: plural rules are also defined for the deprecated tags: + // iw mo sh tl + // Consider removing these as compact tags. + + // Include locales for plural rules, which uses a different structure. + for _, plurals := range b.supp.Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + m[language.Make(lang)] = true + } + } + } + + var coreTags []language.CompactCoreInfo + var special []string + + for t := range m { + if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { + log.Fatalf("Unexpected extension %v in %v", x, t) + } + if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { + cci, ok := language.GetCompactCore(t) + if !ok { + log.Fatalf("Locale for non-basic language %q", t) + } + coreTags = append(coreTags, cci) + } else { + special = append(special, t.String()) + } + } + + w := b.w + + sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] }) + sort.Strings(special) + + w.WriteComment(` + NumCompactTags is the number of common tags. The maximum tag is + NumCompactTags-1.`) + w.WriteConst("NumCompactTags", len(m)) + + fmt.Fprintln(w, "const (") + for i, t := range coreTags { + fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i) + } + for i, t := range special { + fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags)) + } + fmt.Fprintln(w, ")") + + w.WriteVar("coreTags", coreTags) + + w.WriteConst("specialTagsStr", strings.Join(special, " ")) +} + +func ident(s string) string { + return strings.Replace(s, "-", "", -1) + "Index" +} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go new file mode 100644 index 0000000000..9543d58323 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go @@ -0,0 +1,54 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/unicode/cldr" +) + +func main() { + r := gen.OpenCLDRCoreZip() + defer r.Close() + + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatalf("DecodeZip: %v", err) + } + + w := gen.NewCodeWriter() + defer w.WriteGoFile("parents.go", "compact") + + // Create parents table. + type ID uint16 + parents := make([]ID, compact.NumCompactTags) + for _, loc := range data.Locales() { + tag := language.MustParse(loc) + index, ok := compact.FromTag(tag) + if !ok { + continue + } + parentIndex := compact.ID(0) // und + for p := tag.Parent(); p != language.Und; p = p.Parent() { + if x, ok := compact.FromTag(p); ok { + parentIndex = x + break + } + } + parents[index] = ID(parentIndex) + } + + w.WriteComment(` + parents maps a compact index of a tag to the compact index of the parent of + this tag.`) + w.WriteVar("parents", parents) +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000000..83816a72a8 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000000..8d810723c7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000000..554ca354b6 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x0581f000, + 0x0581f032, 0x05857000, 0x05857032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000, + 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105, + 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd, + 0x43257105, 0x4325714d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000, + 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000, + 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000, + 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000, + 0x528000ba, 0x52900000, 0x52938000, 0x52938053, + 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000, + // Entry 300 - 31F + 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: F4E57D15 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000000..ca135d295a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000000..4ae78e0fa5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000000..9b20b88feb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go new file mode 100644 index 0000000000..cdcc7febcb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/gen.go @@ -0,0 +1,1520 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// Language tag table generator. +// Data read from the web. + +package main + +import ( + "bufio" + "flag" + "fmt" + "io" + "io/ioutil" + "log" + "math" + "reflect" + "regexp" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/tag" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", + false, + "test existing tables; can be used to compare web data with package data.") + outputFile = flag.String("output", + "tables.go", + "output file for generated tables") +) + +var comment = []string{ + ` +lang holds an alphabetically sorted list of ISO-639 language identifiers. +All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +For 2-byte language identifiers, the two successive bytes have the following meaning: + - if the first letter of the 2- and 3-letter ISO codes are the same: + the second and third letter of the 3-letter ISO code. + - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +For 3-byte language identifiers the 4th byte is 0.`, + ` +langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +in lookup tables. The language ids for these language codes are derived directly +from the letters and are not consecutive.`, + ` +altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +to 2-letter language codes that cannot be derived using the method described above. +Each 3-letter code is followed by its 1-byte langID.`, + ` +altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, + ` +AliasMap maps langIDs to their suggested replacements.`, + ` +script is an alphabetically sorted list of ISO 15924 codes. The index +of the script in the string, divided by 4, is the internal scriptID.`, + ` +isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +the UN.M49 codes used for groups.)`, + ` +regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +Each 2-letter codes is followed by two bytes with the following meaning: + - [A-Z}{2}: the first letter of the 2-letter code plus these two + letters form the 3-letter ISO code. + - 0, n: index into altRegionISO3.`, + ` +regionTypes defines the status of a region for various standards.`, + ` +m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +codes indicating collections of regions.`, + ` +m49Index gives indexes into fromM49 based on the three most significant bits +of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in + fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +The region code is stored in the 9 lsb of the indexed value.`, + ` +fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, + ` +altRegionISO3 holds a list of 3-letter region codes that cannot be +mapped to 2-letter codes using the default algorithm. This is a short list.`, + ` +altRegionIDs holds a list of regionIDs the positions of which match those +of the 3-letter ISO codes in altRegionISO3.`, + ` +variantNumSpecialized is the number of specialized variants in variants.`, + ` +suppressScript is an index from langID to the dominant script for that language, +if it exists. If a script is given, it should be suppressed from the language tag.`, + ` +likelyLang is a lookup table, indexed by langID, for the most likely +scripts and regions given incomplete information. If more entries exist for a +given language, region and script are the index and size respectively +of the list in likelyLangList.`, + ` +likelyLangList holds lists info associated with likelyLang.`, + ` +likelyRegion is a lookup table, indexed by regionID, for the most likely +languages and scripts given incomplete information. If more entries exist +for a given regionID, lang and script are the index and size respectively +of the list in likelyRegionList. +TODO: exclude containers and user-definable regions from the list.`, + ` +likelyRegionList holds lists info associated with likelyRegion.`, + ` +likelyScript is a lookup table, indexed by scriptID, for the most likely +languages and regions given a script.`, + ` +nRegionGroups is the number of region groups.`, + ` +regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +where each set holds all groupings that are directly connected in a region +containment graph.`, + ` +regionInclusionBits is an array of bit vectors where every vector represents +a set of region groupings. These sets are used to compute the distance +between two regions for the purpose of language matching.`, + ` +regionInclusionNext marks, for each entry in regionInclusionBits, the set of +all groups that are reachable from the groups set in the respective entry.`, +} + +// TODO: consider changing some of these structures to tries. This can reduce +// memory, but may increase the need for memory allocations. This could be +// mitigated if we can piggyback on language tags for common cases. + +func failOnError(e error) { + if e != nil { + log.Panic(e) + } +} + +type setType int + +const ( + Indexed setType = 1 + iota // all elements must be of same size + Linear +) + +type stringSet struct { + s []string + sorted, frozen bool + + // We often need to update values after the creation of an index is completed. + // We include a convenience map for keeping track of this. + update map[string]string + typ setType // used for checking. +} + +func (ss *stringSet) clone() stringSet { + c := *ss + c.s = append([]string(nil), c.s...) + return c +} + +func (ss *stringSet) setType(t setType) { + if ss.typ != t && ss.typ != 0 { + log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) + } +} + +// parse parses a whitespace-separated string and initializes ss with its +// components. +func (ss *stringSet) parse(s string) { + scan := bufio.NewScanner(strings.NewReader(s)) + scan.Split(bufio.ScanWords) + for scan.Scan() { + ss.add(scan.Text()) + } +} + +func (ss *stringSet) assertChangeable() { + if ss.frozen { + log.Panic("attempt to modify a frozen stringSet") + } +} + +func (ss *stringSet) add(s string) { + ss.assertChangeable() + ss.s = append(ss.s, s) + ss.sorted = ss.frozen +} + +func (ss *stringSet) freeze() { + ss.compact() + ss.frozen = true +} + +func (ss *stringSet) compact() { + if ss.sorted { + return + } + a := ss.s + sort.Strings(a) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + a[k+1] = a[i] + k++ + } + } + ss.s = a[:k+1] + ss.sorted = ss.frozen +} + +type funcSorter struct { + fn func(a, b string) bool + sort.StringSlice +} + +func (s funcSorter) Less(i, j int) bool { + return s.fn(s.StringSlice[i], s.StringSlice[j]) +} + +func (ss *stringSet) sortFunc(f func(a, b string) bool) { + ss.compact() + sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) +} + +func (ss *stringSet) remove(s string) { + ss.assertChangeable() + if i, ok := ss.find(s); ok { + copy(ss.s[i:], ss.s[i+1:]) + ss.s = ss.s[:len(ss.s)-1] + } +} + +func (ss *stringSet) replace(ol, nu string) { + ss.s[ss.index(ol)] = nu + ss.sorted = ss.frozen +} + +func (ss *stringSet) index(s string) int { + ss.setType(Indexed) + i, ok := ss.find(s) + if !ok { + if i < len(ss.s) { + log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) + } + log.Panicf("find: item %q is not in list", s) + + } + return i +} + +func (ss *stringSet) find(s string) (int, bool) { + ss.compact() + i := sort.SearchStrings(ss.s, s) + return i, i != len(ss.s) && ss.s[i] == s +} + +func (ss *stringSet) slice() []string { + ss.compact() + return ss.s +} + +func (ss *stringSet) updateLater(v, key string) { + if ss.update == nil { + ss.update = map[string]string{} + } + ss.update[v] = key +} + +// join joins the string and ensures that all entries are of the same length. +func (ss *stringSet) join() string { + ss.setType(Indexed) + n := len(ss.s[0]) + for _, s := range ss.s { + if len(s) != n { + log.Panicf("join: not all entries are of the same length: %q", s) + } + } + ss.s = append(ss.s, strings.Repeat("\xff", n)) + return strings.Join(ss.s, "") +} + +// ianaEntry holds information for an entry in the IANA Language Subtag Repository. +// All types use the same entry. +// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various +// fields. +type ianaEntry struct { + typ string + description []string + scope string + added string + preferred string + deprecated string + suppressScript string + macro string + prefix []string +} + +type builder struct { + w *gen.CodeWriter + hw io.Writer // MultiWriter for w and w.Hash + data *cldr.CLDR + supp *cldr.SupplementalData + + // indices + locale stringSet // common locales + lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data + langNoIndex stringSet // 3-letter ISO codes with no associated data + script stringSet // 4-letter ISO codes + region stringSet // 2-letter ISO or 3-digit UN M49 codes + variant stringSet // 4-8-alphanumeric variant code. + + // Region codes that are groups with their corresponding group IDs. + groups map[int]index + + // langInfo + registry map[string]*ianaEntry +} + +type index uint + +func newBuilder(w *gen.CodeWriter) *builder { + r := gen.OpenCLDRCoreZip() + defer r.Close() + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + failOnError(err) + b := builder{ + w: w, + hw: io.MultiWriter(w, w.Hash), + data: data, + supp: data.Supplemental(), + } + b.parseRegistry() + return &b +} + +func (b *builder) parseRegistry() { + r := gen.OpenIANAFile("assignments/language-subtag-registry") + defer r.Close() + b.registry = make(map[string]*ianaEntry) + + scan := bufio.NewScanner(r) + scan.Split(bufio.ScanWords) + var record *ianaEntry + for more := scan.Scan(); more; { + key := scan.Text() + more = scan.Scan() + value := scan.Text() + switch key { + case "Type:": + record = &ianaEntry{typ: value} + case "Subtag:", "Tag:": + if s := strings.SplitN(value, "..", 2); len(s) > 1 { + for a := s[0]; a <= s[1]; a = inc(a) { + b.addToRegistry(a, record) + } + } else { + b.addToRegistry(value, record) + } + case "Suppress-Script:": + record.suppressScript = value + case "Added:": + record.added = value + case "Deprecated:": + record.deprecated = value + case "Macrolanguage:": + record.macro = value + case "Preferred-Value:": + record.preferred = value + case "Prefix:": + record.prefix = append(record.prefix, value) + case "Scope:": + record.scope = value + case "Description:": + buf := []byte(value) + for more = scan.Scan(); more; more = scan.Scan() { + b := scan.Bytes() + if b[0] == '%' || b[len(b)-1] == ':' { + break + } + buf = append(buf, ' ') + buf = append(buf, b...) + } + record.description = append(record.description, string(buf)) + continue + default: + continue + } + more = scan.Scan() + } + if scan.Err() != nil { + log.Panic(scan.Err()) + } +} + +func (b *builder) addToRegistry(key string, entry *ianaEntry) { + if info, ok := b.registry[key]; ok { + if info.typ != "language" || entry.typ != "extlang" { + log.Fatalf("parseRegistry: tag %q already exists", key) + } + } else { + b.registry[key] = entry + } +} + +var commentIndex = make(map[string]string) + +func init() { + for _, s := range comment { + key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) + commentIndex[key] = s + } +} + +func (b *builder) comment(name string) { + if s := commentIndex[name]; len(s) > 0 { + b.w.WriteComment(s) + } else { + fmt.Fprintln(b.w) + } +} + +func (b *builder) pf(f string, x ...interface{}) { + fmt.Fprintf(b.hw, f, x...) + fmt.Fprint(b.hw, "\n") +} + +func (b *builder) p(x ...interface{}) { + fmt.Fprintln(b.hw, x...) +} + +func (b *builder) addSize(s int) { + b.w.Size += s + b.pf("// Size: %d bytes", s) +} + +func (b *builder) writeConst(name string, x interface{}) { + b.comment(name) + b.w.WriteConst(name, x) +} + +// writeConsts computes f(v) for all v in values and writes the results +// as constants named _v to a single constant block. +func (b *builder) writeConsts(f func(string) int, values ...string) { + b.pf("const (") + for _, v := range values { + b.pf("\t_%s = %v", v, f(v)) + } + b.pf(")") +} + +// writeType writes the type of the given value, which must be a struct. +func (b *builder) writeType(value interface{}) { + b.comment(reflect.TypeOf(value).Name()) + b.w.WriteType(value) +} + +func (b *builder) writeSlice(name string, ss interface{}) { + b.writeSliceAddSize(name, 0, ss) +} + +func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { + b.comment(name) + b.w.Size += extraSize + v := reflect.ValueOf(ss) + t := v.Type().Elem() + b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) + + fmt.Fprintf(b.w, "var %s = ", name) + b.w.WriteArray(ss) + b.p() +} + +type FromTo struct { + From, To uint16 +} + +func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { + ss.sortFunc(func(a, b string) bool { + return index(a) < index(b) + }) + m := []FromTo{} + for _, s := range ss.s { + m = append(m, FromTo{index(s), index(ss.update[s])}) + } + b.writeSlice(name, m) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s string) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +func (b *builder) writeBitVector(name string, ss []string) { + vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) + for _, s := range ss { + v := strToInt(s) + vec[v/8] |= 1 << (v % 8) + } + b.writeSlice(name, vec) +} + +// TODO: convert this type into a list or two-stage trie. +func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size())) + for _, k := range m { + sz += len(k) + } + b.addSize(sz) + keys := []string{} + b.pf(`var %s = map[string]uint16{`, name) + for k := range m { + keys = append(keys, k) + } + sort.Strings(keys) + for _, k := range keys { + b.pf("\t%q: %v,", k, f(m[k])) + } + b.p("}") +} + +func (b *builder) writeMap(name string, m interface{}) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) + b.addSize(sz) + f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { + return strings.IndexRune("{}, ", r) != -1 + }) + sort.Strings(f[1:]) + b.pf(`var %s = %s{`, name, f[0]) + for _, kv := range f[1:] { + b.pf("\t%s,", kv) + } + b.p("}") +} + +func (b *builder) langIndex(s string) uint16 { + if s == "und" { + return 0 + } + if i, ok := b.lang.find(s); ok { + return uint16(i) + } + return uint16(strToInt(s)) + uint16(len(b.lang.s)) +} + +// inc advances the string to its lexicographical successor. +func inc(s string) string { + const maxTagLength = 4 + var buf [maxTagLength]byte + intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) + for i := 0; i < len(s); i++ { + if s[i] <= 'Z' { + buf[i] -= 'a' - 'A' + } + } + return string(buf[:len(s)]) +} + +func (b *builder) parseIndices() { + meta := b.supp.Metadata + + for k, v := range b.registry { + var ss *stringSet + switch v.typ { + case "language": + if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { + b.lang.add(k) + continue + } else { + ss = &b.langNoIndex + } + case "region": + ss = &b.region + case "script": + ss = &b.script + case "variant": + ss = &b.variant + default: + continue + } + ss.add(k) + } + // Include any language for which there is data. + for _, lang := range b.data.Locales() { + if x := b.data.RawLDML(lang); false || + x.LocaleDisplayNames != nil || + x.Characters != nil || + x.Delimiters != nil || + x.Measurement != nil || + x.Dates != nil || + x.Numbers != nil || + x.Units != nil || + x.ListPatterns != nil || + x.Collations != nil || + x.Segmentations != nil || + x.Rbnf != nil || + x.Annotations != nil || + x.Metadata != nil { + + from := strings.Split(lang, "_") + if lang := from[0]; lang != "root" { + b.lang.add(lang) + } + } + } + // Include locales for plural rules, which uses a different structure. + for _, plurals := range b.data.Supplemental().Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + if lang = strings.Split(lang, "_")[0]; lang != "root" { + b.lang.add(lang) + } + } + } + } + // Include languages in likely subtags. + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + b.lang.add(from[0]) + } + // Include ISO-639 alpha-3 bibliographic entries. + for _, a := range meta.Alias.LanguageAlias { + if a.Reason == "bibliographic" { + b.langNoIndex.add(a.Type) + } + } + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 { + b.region.add(reg.Type) + } + } + + for _, s := range b.lang.s { + if len(s) == 3 { + b.langNoIndex.remove(s) + } + } + b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) + b.writeConst("NumScripts", len(b.script.slice())) + b.writeConst("NumRegions", len(b.region.slice())) + + // Add dummy codes at the start of each list to represent "unspecified". + b.lang.add("---") + b.script.add("----") + b.region.add("---") + + // common locales + b.locale.parse(meta.DefaultContent.Locales) +} + +// TODO: region inclusion data will probably not be use used in future matchers. + +func (b *builder) computeRegionGroups() { + b.groups = make(map[int]index) + + // Create group indices. + for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. + b.groups[i] = index(len(b.groups)) + } + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + if _, ok := b.groups[group]; !ok { + b.groups[group] = index(len(b.groups)) + } + } + if len(b.groups) > 64 { + log.Fatalf("only 64 groups supported, found %d", len(b.groups)) + } + b.writeConst("nRegionGroups", len(b.groups)) +} + +var langConsts = []string{ + "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", + "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", + "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", + "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", + "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", + "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", + + // constants for grandfathered tags (if not already defined) + "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", + "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", +} + +// writeLanguage generates all tables needed for language canonicalization. +func (b *builder) writeLanguage() { + meta := b.supp.Metadata + + b.writeConst("nonCanonicalUnd", b.lang.index("und")) + b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) + b.writeConst("langPrivateStart", b.langIndex("qaa")) + b.writeConst("langPrivateEnd", b.langIndex("qtz")) + + // Get language codes that need to be mapped (overlong 3-letter codes, + // deprecated 2-letter codes, legacy and grandfathered tags.) + langAliasMap := stringSet{} + aliasTypeMap := map[string]AliasType{} + + // altLangISO3 get the alternative ISO3 names that need to be mapped. + altLangISO3 := stringSet{} + // Add dummy start to avoid the use of index 0. + altLangISO3.add("---") + altLangISO3.updateLater("---", "aa") + + lang := b.lang.clone() + for _, a := range meta.Alias.LanguageAlias { + if a.Replacement == "" { + a.Replacement = "und" + } + // TODO: support mapping to tags + repl := strings.SplitN(a.Replacement, "_", 2)[0] + if a.Reason == "overlong" { + if len(a.Replacement) == 2 && len(a.Type) == 3 { + lang.updateLater(a.Replacement, a.Type) + } + } else if len(a.Type) <= 3 { + switch a.Reason { + case "macrolanguage": + aliasTypeMap[a.Type] = Macro + case "deprecated": + // handled elsewhere + continue + case "bibliographic", "legacy": + if a.Type == "no" { + continue + } + aliasTypeMap[a.Type] = Legacy + default: + log.Fatalf("new %s alias: %s", a.Reason, a.Type) + } + langAliasMap.add(a.Type) + langAliasMap.updateLater(a.Type, repl) + } + } + // Manually add the mapping of "nb" (Norwegian) to its macro language. + // This can be removed if CLDR adopts this change. + langAliasMap.add("nb") + langAliasMap.updateLater("nb", "no") + aliasTypeMap["nb"] = Macro + + for k, v := range b.registry { + // Also add deprecated values for 3-letter ISO codes, which CLDR omits. + if v.typ == "language" && v.deprecated != "" && v.preferred != "" { + langAliasMap.add(k) + langAliasMap.updateLater(k, v.preferred) + aliasTypeMap[k] = Deprecated + } + } + // Fix CLDR mappings. + lang.updateLater("tl", "tgl") + lang.updateLater("sh", "hbs") + lang.updateLater("mo", "mol") + lang.updateLater("no", "nor") + lang.updateLater("tw", "twi") + lang.updateLater("nb", "nob") + lang.updateLater("ak", "aka") + lang.updateLater("bh", "bih") + + // Ensure that each 2-letter code is matched with a 3-letter code. + for _, v := range lang.s[1:] { + s, ok := lang.update[v] + if !ok { + if s, ok = lang.update[langAliasMap.update[v]]; !ok { + continue + } + lang.update[v] = s + } + if v[0] != s[0] { + altLangISO3.add(s) + altLangISO3.updateLater(s, v) + } + } + + // Complete canonicalized language tags. + lang.freeze() + for i, v := range lang.s { + // We can avoid these manual entries by using the IANA registry directly. + // Seems easier to update the list manually, as changes are rare. + // The panic in this loop will trigger if we miss an entry. + add := "" + if s, ok := lang.update[v]; ok { + if s[0] == v[0] { + add = s[1:] + } else { + add = string([]byte{0, byte(altLangISO3.index(s))}) + } + } else if len(v) == 3 { + add = "\x00" + } else { + log.Panicf("no data for long form of %q", v) + } + lang.s[i] += add + } + b.writeConst("lang", tag.Index(lang.join())) + + b.writeConst("langNoIndexOffset", len(b.lang.s)) + + // space of all valid 3-letter language identifiers. + b.writeBitVector("langNoIndex", b.langNoIndex.slice()) + + altLangIndex := []uint16{} + for i, s := range altLangISO3.slice() { + altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) + if i > 0 { + idx := b.lang.index(altLangISO3.update[s]) + altLangIndex = append(altLangIndex, uint16(idx)) + } + } + b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) + b.writeSlice("altLangIndex", altLangIndex) + + b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex) + types := make([]AliasType, len(langAliasMap.s)) + for i, s := range langAliasMap.s { + types[i] = aliasTypeMap[s] + } + b.writeSlice("AliasTypes", types) +} + +var scriptConsts = []string{ + "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy", + "Zzzz", +} + +func (b *builder) writeScript() { + b.writeConsts(b.script.index, scriptConsts...) + b.writeConst("script", tag.Index(b.script.join())) + + supp := make([]uint8, len(b.lang.slice())) + for i, v := range b.lang.slice()[1:] { + if sc := b.registry[v].suppressScript; sc != "" { + supp[i+1] = uint8(b.script.index(sc)) + } + } + b.writeSlice("suppressScript", supp) + + // There is only one deprecated script in CLDR. This value is hard-coded. + // We check here if the code must be updated. + for _, a := range b.supp.Metadata.Alias.ScriptAlias { + if a.Type != "Qaai" { + log.Panicf("unexpected deprecated stript %q", a.Type) + } + } +} + +func parseM49(s string) int16 { + if len(s) == 0 { + return 0 + } + v, err := strconv.ParseUint(s, 10, 10) + failOnError(err) + return int16(v) +} + +var regionConsts = []string{ + "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", + "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. +} + +func (b *builder) writeRegion() { + b.writeConsts(b.region.index, regionConsts...) + + isoOffset := b.region.index("AA") + m49map := make([]int16, len(b.region.slice())) + fromM49map := make(map[int16]int) + altRegionISO3 := "" + altRegionIDs := []uint16{} + + b.writeConst("isoRegionOffset", isoOffset) + + // 2-letter region lookup and mapping to numeric codes. + regionISO := b.region.clone() + regionISO.s = regionISO.s[isoOffset:] + regionISO.sorted = false + + regionTypes := make([]byte, len(b.region.s)) + + // Is the region valid BCP 47? + for s, e := range b.registry { + if len(s) == 2 && s == strings.ToUpper(s) { + i := b.region.index(s) + for _, d := range e.description { + if strings.Contains(d, "Private use") { + regionTypes[i] = iso3166UserAssigned + } + } + regionTypes[i] |= bcp47Region + } + } + + // Is the region a valid ccTLD? + r := gen.OpenIANAFile("domains/root/db") + defer r.Close() + + buf, err := ioutil.ReadAll(r) + failOnError(err) + re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) + for _, m := range re.FindAllSubmatch(buf, -1) { + i := b.region.index(strings.ToUpper(string(m[1]))) + regionTypes[i] |= ccTLD + } + + b.writeSlice("regionTypes", regionTypes) + + iso3Set := make(map[string]int) + update := func(iso2, iso3 string) { + i := regionISO.index(iso2) + if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { + regionISO.s[i] += iso3[1:] + iso3Set[iso3] = -1 + } else { + if ok && j >= 0 { + regionISO.s[i] += string([]byte{0, byte(j)}) + } else { + iso3Set[iso3] = len(altRegionISO3) + regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) + altRegionISO3 += iso3 + altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + i := regionISO.index(tc.Type) + isoOffset + if d := m49map[i]; d != 0 { + log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) + } + m49 := parseM49(tc.Numeric) + m49map[i] = m49 + if r := fromM49map[m49]; r == 0 { + fromM49map[m49] = i + } else if r != i { + dep := b.registry[regionISO.s[r-isoOffset]].deprecated + if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { + fromM49map[m49] = i + } + } + } + for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { + if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { + from := parseM49(ta.Type) + if r := fromM49map[from]; r == 0 { + fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + if len(tc.Alpha3) == 3 { + update(tc.Type, tc.Alpha3) + } + } + // This entries are not included in territoryCodes. Mostly 3-letter variants + // of deleted codes and an entry for QU. + for _, m := range []struct{ iso2, iso3 string }{ + {"CT", "CTE"}, + {"DY", "DHY"}, + {"HV", "HVO"}, + {"JT", "JTN"}, + {"MI", "MID"}, + {"NH", "NHB"}, + {"NQ", "ATN"}, + {"PC", "PCI"}, + {"PU", "PUS"}, + {"PZ", "PCZ"}, + {"RH", "RHO"}, + {"VD", "VDR"}, + {"WK", "WAK"}, + // These three-letter codes are used for others as well. + {"FQ", "ATF"}, + } { + update(m.iso2, m.iso3) + } + for i, s := range regionISO.s { + if len(s) != 4 { + regionISO.s[i] = s + " " + } + } + b.writeConst("regionISO", tag.Index(regionISO.join())) + b.writeConst("altRegionISO3", altRegionISO3) + b.writeSlice("altRegionIDs", altRegionIDs) + + // Create list of deprecated regions. + // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only + // Transitionally-reserved mapping not included. + regionOldMap := stringSet{} + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { + regionOldMap.add(reg.Type) + regionOldMap.updateLater(reg.Type, reg.Replacement) + i, _ := regionISO.find(reg.Type) + j, _ := regionISO.find(reg.Replacement) + if k := m49map[i+isoOffset]; k == 0 { + m49map[i+isoOffset] = m49map[j+isoOffset] + } + } + } + b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { + return uint16(b.region.index(s)) + }) + // 3-digit region lookup, groupings. + for i := 1; i < isoOffset; i++ { + m := parseM49(b.region.s[i]) + m49map[i] = m + fromM49map[m] = i + } + b.writeSlice("m49", m49map) + + const ( + searchBits = 7 + regionBits = 9 + ) + if len(m49map) >= 1< %d", len(m49map), 1<>searchBits] = int16(len(fromM49)) + } + b.writeSlice("m49Index", m49Index) + b.writeSlice("fromM49", fromM49) +} + +const ( + // TODO: put these lists in regionTypes as user data? Could be used for + // various optimizations and refinements and could be exposed in the API. + iso3166Except = "AC CP DG EA EU FX IC SU TA UK" + iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. + // DY and RH are actually not deleted, but indeterminately reserved. + iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" +) + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func find(list []string, s string) int { + for i, t := range list { + if t == s { + return i + } + } + return -1 +} + +// writeVariants generates per-variant information and creates a map from variant +// name to index value. We assign index values such that sorting multiple +// variants by index value will result in the correct order. +// There are two types of variants: specialized and general. Specialized variants +// are only applicable to certain language or language-script pairs. Generalized +// variants apply to any language. Generalized variants always sort after +// specialized variants. We will therefore always assign a higher index value +// to a generalized variant than any other variant. Generalized variants are +// sorted alphabetically among themselves. +// Specialized variants may also sort after other specialized variants. Such +// variants will be ordered after any of the variants they may follow. +// We assume that if a variant x is followed by a variant y, then for any prefix +// p of x, p-x is a prefix of y. This allows us to order tags based on the +// maximum of the length of any of its prefixes. +// TODO: it is possible to define a set of Prefix values on variants such that +// a total order cannot be defined to the point that this algorithm breaks. +// In other words, we cannot guarantee the same order of variants for the +// future using the same algorithm or for non-compliant combinations of +// variants. For this reason, consider using simple alphabetic sorting +// of variants and ignore Prefix restrictions altogether. +func (b *builder) writeVariant() { + generalized := stringSet{} + specialized := stringSet{} + specializedExtend := stringSet{} + // Collate the variants by type and check assumptions. + for _, v := range b.variant.slice() { + e := b.registry[v] + if len(e.prefix) == 0 { + generalized.add(v) + continue + } + c := strings.Split(e.prefix[0], "-") + hasScriptOrRegion := false + if len(c) > 1 { + _, hasScriptOrRegion = b.script.find(c[1]) + if !hasScriptOrRegion { + _, hasScriptOrRegion = b.region.find(c[1]) + + } + } + if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { + // Variant is preceded by a language. + specialized.add(v) + continue + } + // Variant is preceded by another variant. + specializedExtend.add(v) + prefix := c[0] + "-" + if hasScriptOrRegion { + prefix += c[1] + } + for _, p := range e.prefix { + // Verify that the prefix minus the last element is a prefix of the + // predecessor element. + i := strings.LastIndex(p, "-") + pred := b.registry[p[i+1:]] + if find(pred.prefix, p[:i]) < 0 { + log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) + } + // The sorting used below does not work in the general case. It works + // if we assume that variants that may be followed by others only have + // prefixes of the same length. Verify this. + count := strings.Count(p[:i], "-") + for _, q := range pred.prefix { + if c := strings.Count(q, "-"); c != count { + log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) + } + } + if !strings.HasPrefix(p, prefix) { + log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) + } + } + } + + // Sort extended variants. + a := specializedExtend.s + less := func(v, w string) bool { + // Sort by the maximum number of elements. + maxCount := func(s string) (max int) { + for _, p := range b.registry[s].prefix { + if c := strings.Count(p, "-"); c > max { + max = c + } + } + return + } + if cv, cw := maxCount(v), maxCount(w); cv != cw { + return cv < cw + } + // Sort by name as tie breaker. + return v < w + } + sort.Sort(funcSorter{less, sort.StringSlice(a)}) + specializedExtend.frozen = true + + // Create index from variant name to index. + variantIndex := make(map[string]uint8) + add := func(s []string) { + for _, v := range s { + variantIndex[v] = uint8(len(variantIndex)) + } + } + add(specialized.slice()) + add(specializedExtend.s) + numSpecialized := len(variantIndex) + add(generalized.slice()) + if n := len(variantIndex); n > 255 { + log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) + } + b.writeMap("variantIndex", variantIndex) + b.writeConst("variantNumSpecialized", numSpecialized) +} + +func (b *builder) writeLanguageInfo() { +} + +// writeLikelyData writes tables that are used both for finding parent relations and for +// language matching. Each entry contains additional bits to indicate the status of the +// data to know when it cannot be used for parent relations. +func (b *builder) writeLikelyData() { + const ( + isList = 1 << iota + scriptInFrom + regionInFrom + ) + type ( // generated types + likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 + } + likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 + } + likelyLangRegion struct { + lang uint16 + region uint16 + } + // likelyTag is used for getting likely tags for group regions, where + // the likely region might be a region contained in the group. + likelyTag struct { + lang uint16 + region uint16 + script uint8 + } + ) + var ( // generated variables + likelyRegionGroup = make([]likelyTag, len(b.groups)) + likelyLang = make([]likelyScriptRegion, len(b.lang.s)) + likelyRegion = make([]likelyLangScript, len(b.region.s)) + likelyScript = make([]likelyLangRegion, len(b.script.s)) + likelyLangList = []likelyScriptRegion{} + likelyRegionList = []likelyLangScript{} + ) + type fromTo struct { + from, to []string + } + langToOther := map[int][]fromTo{} + regionToOther := map[int][]fromTo{} + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + to := strings.Split(m.To, "_") + if len(to) != 3 { + log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) + } + if len(from) > 3 { + log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) + } + if from[0] != to[0] && from[0] != "und" { + log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) + } + if len(from) == 3 { + if from[2] != to[2] { + log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) + } + if from[0] != "und" { + log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) + } + } + if len(from) == 1 || from[0] != "und" { + id := 0 + if from[0] != "und" { + id = b.lang.index(from[0]) + } + langToOther[id] = append(langToOther[id], fromTo{from, to}) + } else if len(from) == 2 && len(from[1]) == 4 { + sid := b.script.index(from[1]) + likelyScript[sid].lang = uint16(b.langIndex(to[0])) + likelyScript[sid].region = uint16(b.region.index(to[2])) + } else { + r := b.region.index(from[len(from)-1]) + if id, ok := b.groups[r]; ok { + if from[0] != "und" { + log.Fatalf("region changed unexpectedly: %s -> %s", from, to) + } + likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) + likelyRegionGroup[id].script = uint8(b.script.index(to[1])) + likelyRegionGroup[id].region = uint16(b.region.index(to[2])) + } else { + regionToOther[r] = append(regionToOther[r], fromTo{from, to}) + } + } + } + b.writeType(likelyLangRegion{}) + b.writeSlice("likelyScript", likelyScript) + + for id := range b.lang.s { + list := langToOther[id] + if len(list) == 1 { + likelyLang[id].region = uint16(b.region.index(list[0].to[2])) + likelyLang[id].script = uint8(b.script.index(list[0].to[1])) + } else if len(list) > 1 { + likelyLang[id].flags = isList + likelyLang[id].region = uint16(len(likelyLangList)) + likelyLang[id].script = uint8(len(list)) + for _, x := range list { + flags := uint8(0) + if len(x.from) > 1 { + if x.from[1] == x.to[2] { + flags = regionInFrom + } else { + flags = scriptInFrom + } + } + likelyLangList = append(likelyLangList, likelyScriptRegion{ + region: uint16(b.region.index(x.to[2])), + script: uint8(b.script.index(x.to[1])), + flags: flags, + }) + } + } + } + // TODO: merge suppressScript data with this table. + b.writeType(likelyScriptRegion{}) + b.writeSlice("likelyLang", likelyLang) + b.writeSlice("likelyLangList", likelyLangList) + + for id := range b.region.s { + list := regionToOther[id] + if len(list) == 1 { + likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) + likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) + if len(list[0].from) > 2 { + likelyRegion[id].flags = scriptInFrom + } + } else if len(list) > 1 { + likelyRegion[id].flags = isList + likelyRegion[id].lang = uint16(len(likelyRegionList)) + likelyRegion[id].script = uint8(len(list)) + for i, x := range list { + if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { + log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) + } + x := likelyLangScript{ + lang: uint16(b.langIndex(x.to[0])), + script: uint8(b.script.index(x.to[1])), + } + if len(list[0].from) > 2 { + x.flags = scriptInFrom + } + likelyRegionList = append(likelyRegionList, x) + } + } + } + b.writeType(likelyLangScript{}) + b.writeSlice("likelyRegion", likelyRegion) + b.writeSlice("likelyRegionList", likelyRegionList) + + b.writeType(likelyTag{}) + b.writeSlice("likelyRegionGroup", likelyRegionGroup) +} + +func (b *builder) writeRegionInclusionData() { + var ( + // mm holds for each group the set of groups with a distance of 1. + mm = make(map[int][]index) + + // containment holds for each group the transitive closure of + // containment of other groups. + containment = make(map[index][]index) + ) + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + groupIdx := b.groups[group] + for _, mem := range strings.Split(g.Contains, " ") { + r := b.region.index(mem) + mm[r] = append(mm[r], groupIdx) + if g, ok := b.groups[r]; ok { + mm[group] = append(mm[group], g) + containment[groupIdx] = append(containment[groupIdx], g) + } + } + } + + regionContainment := make([]uint64, len(b.groups)) + for _, g := range b.groups { + l := containment[g] + + // Compute the transitive closure of containment. + for i := 0; i < len(l); i++ { + l = append(l, containment[l[i]]...) + } + + // Compute the bitmask. + regionContainment[g] = 1 << g + for _, v := range l { + regionContainment[g] |= 1 << v + } + } + b.writeSlice("regionContainment", regionContainment) + + regionInclusion := make([]uint8, len(b.region.s)) + bvs := make(map[uint64]index) + // Make the first bitvector positions correspond with the groups. + for r, i := range b.groups { + bv := uint64(1 << i) + for _, g := range mm[r] { + bv |= 1 << g + } + bvs[bv] = i + regionInclusion[r] = uint8(bvs[bv]) + } + for r := 1; r < len(b.region.s); r++ { + if _, ok := b.groups[r]; !ok { + bv := uint64(0) + for _, g := range mm[r] { + bv |= 1 << g + } + if bv == 0 { + // Pick the world for unspecified regions. + bv = 1 << b.groups[b.region.index("001")] + } + if _, ok := bvs[bv]; !ok { + bvs[bv] = index(len(bvs)) + } + regionInclusion[r] = uint8(bvs[bv]) + } + } + b.writeSlice("regionInclusion", regionInclusion) + regionInclusionBits := make([]uint64, len(bvs)) + for k, v := range bvs { + regionInclusionBits[v] = uint64(k) + } + // Add bit vectors for increasingly large distances until a fixed point is reached. + regionInclusionNext := []uint8{} + for i := 0; i < len(regionInclusionBits); i++ { + bits := regionInclusionBits[i] + next := bits + for i := uint(0); i < uint(len(b.groups)); i++ { + if bits&(1< 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +func (t Tag) TypeForKey(key string) string { + if start, end, _ := t.findTypeForKey(key); end != start { + return t.str[start:end] + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, end, _ := t.findTypeForKey(key) + if start != end { + // Remove key tag and leading '-'. + start -= 4 + + // Remove a possible empty extension. + if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, end, hasExt := t.findTypeForKey(key) + if start == end { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + // p points to the hyphen preceding the current token. + if p3 := p + 3; s[p3] == '-' { + // Found a key. + // Check whether we just processed the key that was requested. + if curKey == key { + return start, p, true + } + // Set to the next key and continue scanning type tokens. + curKey = s[p+1 : p3] + if curKey > key { + return p, p, true + } + // Start of the type token sequence. + start = p + 4 + // A type is at least 3 characters long. + p += 7 // 4 + 3 + } else { + // Attribute or type, which is at least 3 characters long. + p += 4 + } + // p points past the third character of a type or attribute. + max := p + 5 // maximum length of token plus hyphen. + if len(s) < max { + max = len(s) + } + for ; p < max && s[p] != '-'; p++ { + } + // Bail if we have exhausted all tokens or if the next token starts + // a new extension. + if p == len(s) || s[p+2] == '-' { + if curKey == key { + return start, p, true + } + return p, p, true + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Language, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go similarity index 80% rename from vendor/golang.org/x/text/language/lookup.go rename to vendor/golang.org/x/text/internal/language/lookup.go index 1d80ac3708..6294b81524 100644 --- a/vendor/golang.org/x/text/language/lookup.go +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -17,11 +17,11 @@ import ( // if it could not be found. func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { if !tag.FixCase(form, key) { - return 0, errSyntax + return 0, ErrSyntax } i := idx.Index(key) if i == -1 { - return 0, mkErrInvalid(key) + return 0, NewValueError(key) } return i, nil } @@ -32,38 +32,45 @@ func searchUint(imap []uint16, key uint16) int { }) } -type langID uint16 +type Language uint16 // getLangID returns the langID of s if s is a canonical subtag // or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (langID, error) { +func getLangID(s []byte) (Language, error) { if len(s) == 2 { return getLangISO2(s) } return getLangISO3(s) } +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + // mapLang returns the mapped langID of id according to mapping m. -func normLang(id langID) (langID, langAliasType) { - k := sort.Search(len(langAliasMap), func(i int) bool { - return langAliasMap[i].from >= uint16(id) +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) }) - if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) { - return langID(langAliasMap[k].to), langAliasTypes[k] + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] } - return id, langAliasTypeUnknown + return id, AliasTypeUnknown } // getLangISO2 returns the langID for the given 2-letter ISO language code // or unknownLang if this does not exist. -func getLangISO2(s []byte) (langID, error) { +func getLangISO2(s []byte) (Language, error) { if !tag.FixCase("zz", s) { - return 0, errSyntax + return 0, ErrSyntax } if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return langID(i), nil + return Language(i), nil } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } const base = 'z' - 'a' + 1 @@ -88,7 +95,7 @@ func intToStr(v uint, s []byte) { // getLangISO3 returns the langID for the given 3-letter ISO language code // or unknownLang if this does not exist. -func getLangISO3(s []byte) (langID, error) { +func getLangISO3(s []byte) (Language, error) { if tag.FixCase("und", s) { // first try to match canonical 3-letter entries for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { @@ -96,7 +103,7 @@ func getLangISO3(s []byte) (langID, error) { // We treat "und" as special and always translate it to "unspecified". // Note that ZZ and Zzzz are private use and are not treated as // unspecified by default. - id := langID(i) + id := Language(i) if id == nonCanonicalUnd { return 0, nil } @@ -104,26 +111,26 @@ func getLangISO3(s []byte) (langID, error) { } } if i := altLangISO3.Index(s); i != -1 { - return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil } n := strToInt(s) if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return langID(n) + langNoIndexOffset, nil + return Language(n) + langNoIndexOffset, nil } // Check for non-canonical uses of ISO3. for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return langID(i), nil + return Language(i), nil } } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } - return 0, errSyntax + return 0, ErrSyntax } -// stringToBuf writes the string to b and returns the number of bytes +// StringToBuf writes the string to b and returns the number of bytes // written. cap(b) must be >= 3. -func (id langID) stringToBuf(b []byte) int { +func (id Language) StringToBuf(b []byte) int { if id >= langNoIndexOffset { intToStr(uint(id)-langNoIndexOffset, b[:3]) return 3 @@ -140,7 +147,7 @@ func (id langID) stringToBuf(b []byte) int { // String returns the BCP 47 representation of the langID. // Use b as variable name, instead of id, to ensure the variable // used is consistent with that of Base in which this type is embedded. -func (b langID) String() string { +func (b Language) String() string { if b == 0 { return "und" } else if b >= langNoIndexOffset { @@ -157,7 +164,7 @@ func (b langID) String() string { } // ISO3 returns the ISO 639-3 language code. -func (b langID) ISO3() string { +func (b Language) ISO3() string { if b == 0 || b >= langNoIndexOffset { return b.String() } @@ -173,15 +180,24 @@ func (b langID) ISO3() string { } // IsPrivateUse reports whether this language code is reserved for private use. -func (b langID) IsPrivateUse() bool { +func (b Language) IsPrivateUse() bool { return langPrivateStart <= b && b <= langPrivateEnd } -type regionID uint16 +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 // getRegionID returns the region id for s if s is a valid 2-letter region code // or unknownRegion. -func getRegionID(s []byte) (regionID, error) { +func getRegionID(s []byte) (Region, error) { if len(s) == 3 { if isAlpha(s[0]) { return getRegionISO3(s) @@ -195,34 +211,34 @@ func getRegionID(s []byte) (regionID, error) { // getRegionISO2 returns the regionID for the given 2-letter ISO country code // or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (regionID, error) { +func getRegionISO2(s []byte) (Region, error) { i, err := findIndex(regionISO, s, "ZZ") if err != nil { return 0, err } - return regionID(i) + isoRegionOffset, nil + return Region(i) + isoRegionOffset, nil } // getRegionISO3 returns the regionID for the given 3-letter ISO country code // or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (regionID, error) { +func getRegionISO3(s []byte) (Region, error) { if tag.FixCase("ZZZ", s) { for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return regionID(i) + isoRegionOffset, nil + return Region(i) + isoRegionOffset, nil } } for i := 0; i < len(altRegionISO3); i += 3 { if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return regionID(altRegionIDs[i/3]), nil + return Region(altRegionIDs[i/3]), nil } } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } - return 0, errSyntax + return 0, ErrSyntax } -func getRegionM49(n int) (regionID, error) { +func getRegionM49(n int) (Region, error) { if 0 < n && n <= 999 { const ( searchBits = 7 @@ -236,7 +252,7 @@ func getRegionM49(n int) (regionID, error) { return buf[i] >= val }) if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return regionID(r & regionMask), nil + return Region(r & regionMask), nil } } var e ValueError @@ -247,13 +263,13 @@ func getRegionM49(n int) (regionID, error) { // normRegion returns a region if r is deprecated or 0 otherwise. // TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). // TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r regionID) regionID { +func normRegion(r Region) Region { m := regionOldMap k := sort.Search(len(m), func(i int) bool { - return m[i].from >= uint16(r) + return m[i].From >= uint16(r) }) - if k < len(m) && m[k].from == uint16(r) { - return regionID(m[k].to) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) } return 0 } @@ -264,13 +280,13 @@ const ( bcp47Region ) -func (r regionID) typ() byte { +func (r Region) typ() byte { return regionTypes[r] } // String returns the BCP 47 representation for the region. // It returns "ZZ" for an unspecified region. -func (r regionID) String() string { +func (r Region) String() string { if r < isoRegionOffset { if r == 0 { return "ZZ" @@ -284,7 +300,7 @@ func (r regionID) String() string { // ISO3 returns the 3-letter ISO code of r. // Note that not all regions have a 3-letter ISO code. // In such cases this method returns "ZZZ". -func (r regionID) ISO3() string { +func (r Region) ISO3() string { if r < isoRegionOffset { return "ZZZ" } @@ -301,29 +317,29 @@ func (r regionID) ISO3() string { // M49 returns the UN M.49 encoding of r, or 0 if this encoding // is not defined for r. -func (r regionID) M49() int { +func (r Region) M49() int { return int(m49[r]) } // IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This // may include private-use tags that are assigned by CLDR and used in this // implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r regionID) IsPrivateUse() bool { +func (r Region) IsPrivateUse() bool { return r.typ()&iso3166UserAssigned != 0 } -type scriptID uint8 +type Script uint8 // getScriptID returns the script id for string s. It assumes that s // is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (scriptID, error) { +func getScriptID(idx tag.Index, s []byte) (Script, error) { i, err := findIndex(idx, s, "Zzzz") - return scriptID(i), err + return Script(i), err } // String returns the script code in title case. // It returns "Zzzz" for an unspecified script. -func (s scriptID) String() string { +func (s Script) String() string { if s == 0 { return "Zzzz" } @@ -331,7 +347,7 @@ func (s scriptID) String() string { } // IsPrivateUse reports whether this script code is reserved for private use. -func (s scriptID) IsPrivateUse() bool { +func (s Script) IsPrivateUse() bool { return _Qaaa <= s && s <= _Qabx } @@ -389,7 +405,7 @@ func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { if v < 0 { return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true } - t.lang = langID(v) + t.LangID = Language(v) return t, true } return t, false diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000000..75a2dbca76 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000000..2be83e1da5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,594 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + if end < cap(s.b) { + b := make([]byte, len(s.b)+diff) + copy(b, s.b[:oldStart]) + copy(b[end:], s.b[oldEnd:]) + s.b = b + } else { + s.b = append(s.b[end:], s.b[oldEnd:]...) + } + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +func parseTag(scan *scanner) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + copy(scan.b[langStart:], lang.String()) + scan.b[langStart+3] = '-' + scan.start = langStart + 4 + } + scan.gobble(e) + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + keyEnd := scan.end + end = scan.acceptMinSize(3) + // TODO: check key value validity + if keyEnd == end || bytes.Compare(key, last) != 1 { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart, keyEnd := scan.start, scan.end + end = scan.acceptMinSize(3) + if keyEnd != end { + keys = append(keys, scan.b[keyStart:end]) + } else { + scan.setError(ErrSyntax) + end = keyStart + } + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000000..239e2d29eb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3431 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8665 + +const NumScripts = 242 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, + 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 656 bytes, 164 elements +var AliasMap = [164]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x73e, To: 0x21a1}, + 20: {From: 0x7b3, To: 0x56}, + 21: {From: 0x7b9, To: 0x299b}, + 22: {From: 0x7c5, To: 0x58}, + 23: {From: 0x7e6, To: 0x145}, + 24: {From: 0x80c, To: 0x5a}, + 25: {From: 0x815, To: 0x8d}, + 26: {From: 0x87e, To: 0x810}, + 27: {From: 0x8c3, To: 0xee3}, + 28: {From: 0x9ef, To: 0x331}, + 29: {From: 0xa36, To: 0x2c5}, + 30: {From: 0xa3d, To: 0xbf}, + 31: {From: 0xabe, To: 0x3322}, + 32: {From: 0xb38, To: 0x529}, + 33: {From: 0xb75, To: 0x265a}, + 34: {From: 0xb7e, To: 0xbc3}, + 35: {From: 0xb9b, To: 0x44e}, + 36: {From: 0xbbc, To: 0x4229}, + 37: {From: 0xbbf, To: 0x529}, + 38: {From: 0xbfe, To: 0x2da7}, + 39: {From: 0xc2e, To: 0x3181}, + 40: {From: 0xcb9, To: 0xf3}, + 41: {From: 0xd08, To: 0xfa}, + 42: {From: 0xdc8, To: 0x11a}, + 43: {From: 0xdd7, To: 0x32d}, + 44: {From: 0xdf8, To: 0xdfb}, + 45: {From: 0xdfe, To: 0x531}, + 46: {From: 0xedf, To: 0x205a}, + 47: {From: 0xeee, To: 0x2e9a}, + 48: {From: 0xf39, To: 0x367}, + 49: {From: 0x10d0, To: 0x140}, + 50: {From: 0x1104, To: 0x2d0}, + 51: {From: 0x11a0, To: 0x1ec}, + 52: {From: 0x1279, To: 0x21}, + 53: {From: 0x1424, To: 0x15e}, + 54: {From: 0x1470, To: 0x14e}, + 55: {From: 0x151f, To: 0xd9b}, + 56: {From: 0x1523, To: 0x390}, + 57: {From: 0x1532, To: 0x19f}, + 58: {From: 0x1580, To: 0x210}, + 59: {From: 0x1583, To: 0x10d}, + 60: {From: 0x15a3, To: 0x3caf}, + 61: {From: 0x166a, To: 0x19b}, + 62: {From: 0x16c8, To: 0x136}, + 63: {From: 0x1700, To: 0x29f8}, + 64: {From: 0x1718, To: 0x194}, + 65: {From: 0x1727, To: 0xf3f}, + 66: {From: 0x177a, To: 0x178}, + 67: {From: 0x1809, To: 0x17b6}, + 68: {From: 0x1816, To: 0x18f3}, + 69: {From: 0x188a, To: 0x436}, + 70: {From: 0x1979, To: 0x1d01}, + 71: {From: 0x1a74, To: 0x2bb0}, + 72: {From: 0x1a8a, To: 0x1f8}, + 73: {From: 0x1b5a, To: 0x1fa}, + 74: {From: 0x1b86, To: 0x1515}, + 75: {From: 0x1d64, To: 0x2c9b}, + 76: {From: 0x2038, To: 0x37b1}, + 77: {From: 0x203d, To: 0x20dd}, + 78: {From: 0x205a, To: 0x30b}, + 79: {From: 0x20e3, To: 0x274}, + 80: {From: 0x20ee, To: 0x263}, + 81: {From: 0x20f2, To: 0x22d}, + 82: {From: 0x20f9, To: 0x256}, + 83: {From: 0x210f, To: 0x21eb}, + 84: {From: 0x2135, To: 0x27d}, + 85: {From: 0x2160, To: 0x913}, + 86: {From: 0x2199, To: 0x121}, + 87: {From: 0x21ce, To: 0x1561}, + 88: {From: 0x21e6, To: 0x504}, + 89: {From: 0x21f4, To: 0x49f}, + 90: {From: 0x222d, To: 0x121}, + 91: {From: 0x2237, To: 0x121}, + 92: {From: 0x2262, To: 0x92a}, + 93: {From: 0x2316, To: 0x3226}, + 94: {From: 0x2382, To: 0x3365}, + 95: {From: 0x2472, To: 0x2c7}, + 96: {From: 0x24e4, To: 0x2ff}, + 97: {From: 0x24f0, To: 0x2fa}, + 98: {From: 0x24fa, To: 0x31f}, + 99: {From: 0x2550, To: 0xb5b}, + 100: {From: 0x25a9, To: 0xe2}, + 101: {From: 0x263e, To: 0x2d0}, + 102: {From: 0x26c9, To: 0x26b4}, + 103: {From: 0x26f9, To: 0x3c8}, + 104: {From: 0x2727, To: 0x3caf}, + 105: {From: 0x2765, To: 0x26b4}, + 106: {From: 0x2789, To: 0x4358}, + 107: {From: 0x28ef, To: 0x2837}, + 108: {From: 0x2914, To: 0x351}, + 109: {From: 0x2986, To: 0x2da7}, + 110: {From: 0x2b1a, To: 0x38d}, + 111: {From: 0x2bfc, To: 0x395}, + 112: {From: 0x2c3f, To: 0x3caf}, + 113: {From: 0x2cfc, To: 0x3be}, + 114: {From: 0x2d13, To: 0x597}, + 115: {From: 0x2d47, To: 0x148}, + 116: {From: 0x2d48, To: 0x148}, + 117: {From: 0x2dff, To: 0x2f1}, + 118: {From: 0x2e08, To: 0x19cc}, + 119: {From: 0x2e1a, To: 0x2d95}, + 120: {From: 0x2e21, To: 0x292}, + 121: {From: 0x2e54, To: 0x7d}, + 122: {From: 0x2e65, To: 0x2282}, + 123: {From: 0x2ea0, To: 0x2e9b}, + 124: {From: 0x2eef, To: 0x2ed7}, + 125: {From: 0x3193, To: 0x3c4}, + 126: {From: 0x3366, To: 0x338e}, + 127: {From: 0x342a, To: 0x3dc}, + 128: {From: 0x34ee, To: 0x18d0}, + 129: {From: 0x35c8, To: 0x2c9b}, + 130: {From: 0x35e6, To: 0x412}, + 131: {From: 0x3658, To: 0x246}, + 132: {From: 0x3676, To: 0x3f4}, + 133: {From: 0x36fd, To: 0x445}, + 134: {From: 0x37c0, To: 0x121}, + 135: {From: 0x3816, To: 0x38f2}, + 136: {From: 0x382b, To: 0x2c9b}, + 137: {From: 0x382f, To: 0xa9}, + 138: {From: 0x3832, To: 0x3228}, + 139: {From: 0x386c, To: 0x39a6}, + 140: {From: 0x3892, To: 0x3fc0}, + 141: {From: 0x38a5, To: 0x39d7}, + 142: {From: 0x38b4, To: 0x1fa4}, + 143: {From: 0x38b5, To: 0x2e9a}, + 144: {From: 0x395c, To: 0x47e}, + 145: {From: 0x3b4e, To: 0xd91}, + 146: {From: 0x3b78, To: 0x137}, + 147: {From: 0x3c99, To: 0x4bc}, + 148: {From: 0x3fbd, To: 0x100}, + 149: {From: 0x4208, To: 0xa91}, + 150: {From: 0x42be, To: 0x573}, + 151: {From: 0x42f9, To: 0x3f60}, + 152: {From: 0x4378, To: 0x25a}, + 153: {From: 0x43cb, To: 0x36cb}, + 154: {From: 0x43cd, To: 0x10f}, + 155: {From: 0x44af, To: 0x3322}, + 156: {From: 0x44e3, To: 0x512}, + 157: {From: 0x45ca, To: 0x2409}, + 158: {From: 0x45dd, To: 0x26dc}, + 159: {From: 0x4610, To: 0x48ae}, + 160: {From: 0x46ae, To: 0x46a0}, + 161: {From: 0x473e, To: 0x4745}, + 162: {From: 0x4916, To: 0x31f}, + 163: {From: 0x49a7, To: 0x523}, +} + +// Size: 164 bytes, 164 elements +var AliasTypes = [164]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, + // Entry 40 - 7F + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, + 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, + 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, + // Entry 80 - BF + 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, + 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, + 0, 1, 1, 1, +} + +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 976 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + + "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + + "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + + "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + + "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + + "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + + "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + + "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + + "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + + "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + + "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + + "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + + "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, + // Entry 140 - 17F + 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 480 - 4BF + 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 1615 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x4d, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x4f, + "aluku": 0x7, + "ao1990": 0x8, + "arevela": 0x9, + "arevmda": 0xa, + "asante": 0xb, + "baku1926": 0xc, + "balanka": 0xd, + "barla": 0xe, + "basiceng": 0xf, + "bauddha": 0x10, + "biscayan": 0x11, + "biske": 0x48, + "bohoric": 0x12, + "boont": 0x13, + "colb1945": 0x14, + "cornu": 0x15, + "dajnko": 0x16, + "ekavsk": 0x17, + "emodeng": 0x18, + "fonipa": 0x50, + "fonnapa": 0x51, + "fonupa": 0x52, + "fonxsamp": 0x53, + "hepburn": 0x19, + "heploc": 0x4e, + "hognorsk": 0x1a, + "hsistemo": 0x1b, + "ijekavsk": 0x1c, + "itihasa": 0x1d, + "jauer": 0x1e, + "jyutping": 0x1f, + "kkcor": 0x20, + "kociewie": 0x21, + "kscor": 0x22, + "laukika": 0x23, + "lipaw": 0x49, + "luna1918": 0x24, + "metelko": 0x25, + "monoton": 0x26, + "ndyuka": 0x27, + "nedis": 0x28, + "newfound": 0x29, + "njiva": 0x4a, + "nulik": 0x2a, + "osojs": 0x4b, + "oxendict": 0x2b, + "pahawh2": 0x2c, + "pahawh3": 0x2d, + "pahawh4": 0x2e, + "pamaka": 0x2f, + "petr1708": 0x30, + "pinyin": 0x31, + "polyton": 0x32, + "puter": 0x33, + "rigik": 0x34, + "rozaj": 0x35, + "rumgr": 0x36, + "scotland": 0x37, + "scouse": 0x38, + "simple": 0x54, + "solba": 0x4c, + "sotav": 0x39, + "spanglis": 0x3a, + "surmiran": 0x3b, + "sursilv": 0x3c, + "sutsilv": 0x3d, + "tarask": 0x3e, + "uccor": 0x3f, + "ucrcor": 0x40, + "ulster": 0x41, + "unifon": 0x42, + "vaidika": 0x43, + "valencia": 0x44, + "vallader": 0x45, + "wadegile": 0x46, + "xsistemo": 0x47, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 79 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 976 bytes, 244 elements +var likelyScript = [244]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 28: {lang: 0xf1, region: 0x6b}, + 30: {lang: 0x1a0, region: 0x5d}, + 31: {lang: 0x3e2, region: 0x106}, + 33: {lang: 0x1be, region: 0x99}, + 36: {lang: 0x15e, region: 0x78}, + 39: {lang: 0x133, region: 0x6b}, + 40: {lang: 0x431, region: 0x27}, + 41: {lang: 0x27, region: 0x6f}, + 43: {lang: 0x210, region: 0x7d}, + 44: {lang: 0xfe, region: 0x38}, + 46: {lang: 0x19b, region: 0x99}, + 47: {lang: 0x19e, region: 0x130}, + 48: {lang: 0x3e9, region: 0x99}, + 49: {lang: 0x136, region: 0x87}, + 50: {lang: 0x1a4, region: 0x99}, + 51: {lang: 0x39d, region: 0x99}, + 52: {lang: 0x529, region: 0x12e}, + 53: {lang: 0x254, region: 0xab}, + 54: {lang: 0x529, region: 0x53}, + 55: {lang: 0x1cb, region: 0xe7}, + 56: {lang: 0x529, region: 0x53}, + 57: {lang: 0x529, region: 0x12e}, + 58: {lang: 0x2fd, region: 0x9b}, + 59: {lang: 0x1bc, region: 0x97}, + 60: {lang: 0x200, region: 0xa2}, + 61: {lang: 0x1c5, region: 0x12b}, + 62: {lang: 0x1ca, region: 0xaf}, + 65: {lang: 0x1d5, region: 0x92}, + 67: {lang: 0x142, region: 0x9e}, + 68: {lang: 0x254, region: 0xab}, + 69: {lang: 0x20e, region: 0x95}, + 70: {lang: 0x200, region: 0xa2}, + 72: {lang: 0x135, region: 0xc4}, + 73: {lang: 0x200, region: 0xa2}, + 74: {lang: 0x3bb, region: 0xe8}, + 75: {lang: 0x24a, region: 0xa6}, + 76: {lang: 0x3fa, region: 0x99}, + 79: {lang: 0x251, region: 0x99}, + 80: {lang: 0x254, region: 0xab}, + 82: {lang: 0x88, region: 0x99}, + 83: {lang: 0x370, region: 0x123}, + 84: {lang: 0x2b8, region: 0xaf}, + 89: {lang: 0x29f, region: 0x99}, + 90: {lang: 0x2a8, region: 0x99}, + 91: {lang: 0x28f, region: 0x87}, + 92: {lang: 0x1a0, region: 0x87}, + 93: {lang: 0x2ac, region: 0x53}, + 95: {lang: 0x4f4, region: 0x12b}, + 96: {lang: 0x4f5, region: 0x12b}, + 97: {lang: 0x1be, region: 0x99}, + 99: {lang: 0x337, region: 0x9c}, + 100: {lang: 0x4f7, region: 0x53}, + 101: {lang: 0xa9, region: 0x53}, + 104: {lang: 0x2e8, region: 0x112}, + 105: {lang: 0x4f8, region: 0x10b}, + 106: {lang: 0x4f8, region: 0x10b}, + 107: {lang: 0x304, region: 0x99}, + 108: {lang: 0x31b, region: 0x99}, + 109: {lang: 0x30b, region: 0x53}, + 111: {lang: 0x31e, region: 0x35}, + 112: {lang: 0x30e, region: 0x99}, + 113: {lang: 0x414, region: 0xe8}, + 114: {lang: 0x331, region: 0xc4}, + 115: {lang: 0x4f9, region: 0x108}, + 116: {lang: 0x3b, region: 0xa1}, + 117: {lang: 0x353, region: 0xdb}, + 120: {lang: 0x2d0, region: 0x84}, + 121: {lang: 0x52a, region: 0x53}, + 122: {lang: 0x403, region: 0x96}, + 123: {lang: 0x3ee, region: 0x99}, + 124: {lang: 0x39b, region: 0xc5}, + 125: {lang: 0x395, region: 0x99}, + 126: {lang: 0x399, region: 0x135}, + 127: {lang: 0x429, region: 0x115}, + 128: {lang: 0x3b, region: 0x11c}, + 129: {lang: 0xfd, region: 0xc4}, + 130: {lang: 0x27d, region: 0x106}, + 131: {lang: 0x2c9, region: 0x53}, + 132: {lang: 0x39f, region: 0x9c}, + 133: {lang: 0x39f, region: 0x53}, + 135: {lang: 0x3ad, region: 0xb0}, + 137: {lang: 0x1c6, region: 0x53}, + 138: {lang: 0x4fd, region: 0x9c}, + 189: {lang: 0x3cb, region: 0x95}, + 191: {lang: 0x372, region: 0x10c}, + 192: {lang: 0x420, region: 0x97}, + 194: {lang: 0x4ff, region: 0x15e}, + 195: {lang: 0x3f0, region: 0x99}, + 196: {lang: 0x45, region: 0x135}, + 197: {lang: 0x139, region: 0x7b}, + 198: {lang: 0x3e9, region: 0x99}, + 200: {lang: 0x3e9, region: 0x99}, + 201: {lang: 0x3fa, region: 0x99}, + 202: {lang: 0x40c, region: 0xb3}, + 203: {lang: 0x433, region: 0x99}, + 204: {lang: 0xef, region: 0xc5}, + 205: {lang: 0x43e, region: 0x95}, + 206: {lang: 0x44d, region: 0x35}, + 207: {lang: 0x44e, region: 0x9b}, + 211: {lang: 0x45a, region: 0xe7}, + 212: {lang: 0x11a, region: 0x99}, + 213: {lang: 0x45e, region: 0x53}, + 214: {lang: 0x232, region: 0x53}, + 215: {lang: 0x450, region: 0x99}, + 216: {lang: 0x4a5, region: 0x53}, + 217: {lang: 0x9f, region: 0x13e}, + 218: {lang: 0x461, region: 0x99}, + 220: {lang: 0x528, region: 0xba}, + 221: {lang: 0x153, region: 0xe7}, + 222: {lang: 0x128, region: 0xcd}, + 223: {lang: 0x46b, region: 0x123}, + 224: {lang: 0xa9, region: 0x53}, + 225: {lang: 0x2ce, region: 0x99}, + 226: {lang: 0x4ad, region: 0x11c}, + 227: {lang: 0x4be, region: 0xb4}, + 229: {lang: 0x1ce, region: 0x99}, + 232: {lang: 0x3a9, region: 0x9c}, + 233: {lang: 0x22, region: 0x9b}, + 234: {lang: 0x1ea, region: 0x53}, + 235: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 5320 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x57, flags: 0x0}, + 1: {region: 0x6f, script: 0x57, flags: 0x0}, + 2: {region: 0x165, script: 0x57, flags: 0x0}, + 3: {region: 0x165, script: 0x57, flags: 0x0}, + 4: {region: 0x165, script: 0x57, flags: 0x0}, + 5: {region: 0x7d, script: 0x1f, flags: 0x0}, + 6: {region: 0x165, script: 0x57, flags: 0x0}, + 7: {region: 0x165, script: 0x1f, flags: 0x0}, + 8: {region: 0x80, script: 0x57, flags: 0x0}, + 9: {region: 0x165, script: 0x57, flags: 0x0}, + 10: {region: 0x165, script: 0x57, flags: 0x0}, + 11: {region: 0x165, script: 0x57, flags: 0x0}, + 12: {region: 0x95, script: 0x57, flags: 0x0}, + 13: {region: 0x131, script: 0x57, flags: 0x0}, + 14: {region: 0x80, script: 0x57, flags: 0x0}, + 15: {region: 0x165, script: 0x57, flags: 0x0}, + 16: {region: 0x165, script: 0x57, flags: 0x0}, + 17: {region: 0x106, script: 0x1f, flags: 0x0}, + 18: {region: 0x165, script: 0x57, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x57, flags: 0x0}, + 22: {region: 0x161, script: 0x57, flags: 0x0}, + 23: {region: 0x165, script: 0x57, flags: 0x0}, + 24: {region: 0x165, script: 0x57, flags: 0x0}, + 25: {region: 0x165, script: 0x57, flags: 0x0}, + 26: {region: 0x165, script: 0x57, flags: 0x0}, + 27: {region: 0x165, script: 0x57, flags: 0x0}, + 28: {region: 0x52, script: 0x57, flags: 0x0}, + 29: {region: 0x165, script: 0x57, flags: 0x0}, + 30: {region: 0x165, script: 0x57, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x57, flags: 0x0}, + 33: {region: 0x80, script: 0x57, flags: 0x0}, + 34: {region: 0x9b, script: 0xe9, flags: 0x0}, + 35: {region: 0x165, script: 0x57, flags: 0x0}, + 36: {region: 0x165, script: 0x57, flags: 0x0}, + 37: {region: 0x14d, script: 0x57, flags: 0x0}, + 38: {region: 0x106, script: 0x1f, flags: 0x0}, + 39: {region: 0x6f, script: 0x29, flags: 0x0}, + 40: {region: 0x165, script: 0x57, flags: 0x0}, + 41: {region: 0x165, script: 0x57, flags: 0x0}, + 42: {region: 0xd6, script: 0x57, flags: 0x0}, + 43: {region: 0x165, script: 0x57, flags: 0x0}, + 45: {region: 0x165, script: 0x57, flags: 0x0}, + 46: {region: 0x165, script: 0x57, flags: 0x0}, + 47: {region: 0x165, script: 0x57, flags: 0x0}, + 48: {region: 0x165, script: 0x57, flags: 0x0}, + 49: {region: 0x165, script: 0x57, flags: 0x0}, + 50: {region: 0x165, script: 0x57, flags: 0x0}, + 51: {region: 0x95, script: 0x57, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x57, flags: 0x0}, + 55: {region: 0x165, script: 0x57, flags: 0x0}, + 56: {region: 0x165, script: 0x57, flags: 0x0}, + 57: {region: 0x165, script: 0x57, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x57, flags: 0x0}, + 61: {region: 0x51, script: 0x57, flags: 0x0}, + 62: {region: 0x3f, script: 0x57, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x57, flags: 0x0}, + 69: {region: 0x135, script: 0xc4, flags: 0x0}, + 70: {region: 0x165, script: 0x57, flags: 0x0}, + 71: {region: 0x165, script: 0x57, flags: 0x0}, + 72: {region: 0x6e, script: 0x57, flags: 0x0}, + 73: {region: 0x165, script: 0x57, flags: 0x0}, + 74: {region: 0x165, script: 0x57, flags: 0x0}, + 75: {region: 0x49, script: 0x57, flags: 0x0}, + 76: {region: 0x165, script: 0x57, flags: 0x0}, + 77: {region: 0x106, script: 0x1f, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x57, flags: 0x0}, + 80: {region: 0x165, script: 0x57, flags: 0x0}, + 81: {region: 0x165, script: 0x57, flags: 0x0}, + 82: {region: 0x99, script: 0x21, flags: 0x0}, + 83: {region: 0x165, script: 0x57, flags: 0x0}, + 84: {region: 0x165, script: 0x57, flags: 0x0}, + 85: {region: 0x165, script: 0x57, flags: 0x0}, + 86: {region: 0x3f, script: 0x57, flags: 0x0}, + 87: {region: 0x165, script: 0x57, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x1f, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x57, flags: 0x0}, + 92: {region: 0xdb, script: 0x21, flags: 0x0}, + 93: {region: 0x2e, script: 0x57, flags: 0x0}, + 94: {region: 0x52, script: 0x57, flags: 0x0}, + 95: {region: 0x165, script: 0x57, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x57, flags: 0x0}, + 98: {region: 0x165, script: 0x57, flags: 0x0}, + 99: {region: 0x95, script: 0x57, flags: 0x0}, + 100: {region: 0x165, script: 0x57, flags: 0x0}, + 101: {region: 0x52, script: 0x57, flags: 0x0}, + 102: {region: 0x165, script: 0x57, flags: 0x0}, + 103: {region: 0x165, script: 0x57, flags: 0x0}, + 104: {region: 0x165, script: 0x57, flags: 0x0}, + 105: {region: 0x165, script: 0x57, flags: 0x0}, + 106: {region: 0x4f, script: 0x57, flags: 0x0}, + 107: {region: 0x165, script: 0x57, flags: 0x0}, + 108: {region: 0x165, script: 0x57, flags: 0x0}, + 109: {region: 0x165, script: 0x57, flags: 0x0}, + 110: {region: 0x165, script: 0x29, flags: 0x0}, + 111: {region: 0x165, script: 0x57, flags: 0x0}, + 112: {region: 0x165, script: 0x57, flags: 0x0}, + 113: {region: 0x47, script: 0x1f, flags: 0x0}, + 114: {region: 0x165, script: 0x57, flags: 0x0}, + 115: {region: 0x165, script: 0x57, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x57, flags: 0x0}, + 118: {region: 0x165, script: 0x57, flags: 0x0}, + 119: {region: 0x95, script: 0x57, flags: 0x0}, + 120: {region: 0x165, script: 0x57, flags: 0x0}, + 121: {region: 0x12f, script: 0x57, flags: 0x0}, + 122: {region: 0x52, script: 0x57, flags: 0x0}, + 123: {region: 0x99, script: 0xd7, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x21, flags: 0x0}, + 126: {region: 0x38, script: 0x1f, flags: 0x0}, + 127: {region: 0x99, script: 0x21, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x31, flags: 0x0}, + 131: {region: 0x99, script: 0x21, flags: 0x0}, + 132: {region: 0x165, script: 0x57, flags: 0x0}, + 133: {region: 0x99, script: 0x21, flags: 0x0}, + 134: {region: 0xe7, script: 0x57, flags: 0x0}, + 135: {region: 0x165, script: 0x57, flags: 0x0}, + 136: {region: 0x99, script: 0x21, flags: 0x0}, + 137: {region: 0x165, script: 0x57, flags: 0x0}, + 138: {region: 0x13f, script: 0x57, flags: 0x0}, + 139: {region: 0x165, script: 0x57, flags: 0x0}, + 140: {region: 0x165, script: 0x57, flags: 0x0}, + 141: {region: 0xe7, script: 0x57, flags: 0x0}, + 142: {region: 0x165, script: 0x57, flags: 0x0}, + 143: {region: 0xd6, script: 0x57, flags: 0x0}, + 144: {region: 0x165, script: 0x57, flags: 0x0}, + 145: {region: 0x165, script: 0x57, flags: 0x0}, + 146: {region: 0x165, script: 0x57, flags: 0x0}, + 147: {region: 0x165, script: 0x29, flags: 0x0}, + 148: {region: 0x99, script: 0x21, flags: 0x0}, + 149: {region: 0x95, script: 0x57, flags: 0x0}, + 150: {region: 0x165, script: 0x57, flags: 0x0}, + 151: {region: 0x165, script: 0x57, flags: 0x0}, + 152: {region: 0x114, script: 0x57, flags: 0x0}, + 153: {region: 0x165, script: 0x57, flags: 0x0}, + 154: {region: 0x165, script: 0x57, flags: 0x0}, + 155: {region: 0x52, script: 0x57, flags: 0x0}, + 156: {region: 0x165, script: 0x57, flags: 0x0}, + 157: {region: 0xe7, script: 0x57, flags: 0x0}, + 158: {region: 0x165, script: 0x57, flags: 0x0}, + 159: {region: 0x13e, script: 0xd9, flags: 0x0}, + 160: {region: 0xc3, script: 0x57, flags: 0x0}, + 161: {region: 0x165, script: 0x57, flags: 0x0}, + 162: {region: 0x165, script: 0x57, flags: 0x0}, + 163: {region: 0xc3, script: 0x57, flags: 0x0}, + 164: {region: 0x165, script: 0x57, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x57, flags: 0x0}, + 167: {region: 0x165, script: 0x57, flags: 0x0}, + 168: {region: 0x165, script: 0x57, flags: 0x0}, + 169: {region: 0x53, script: 0xe0, flags: 0x0}, + 170: {region: 0x165, script: 0x57, flags: 0x0}, + 171: {region: 0x165, script: 0x57, flags: 0x0}, + 172: {region: 0x165, script: 0x57, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x57, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x57, flags: 0x0}, + 177: {region: 0x4f, script: 0x57, flags: 0x0}, + 178: {region: 0x78, script: 0x57, flags: 0x0}, + 179: {region: 0x99, script: 0x21, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x21, flags: 0x0}, + 182: {region: 0x165, script: 0x57, flags: 0x0}, + 183: {region: 0x33, script: 0x57, flags: 0x0}, + 184: {region: 0x165, script: 0x57, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x57, flags: 0x0}, + 187: {region: 0x165, script: 0x29, flags: 0x0}, + 188: {region: 0xe7, script: 0x57, flags: 0x0}, + 189: {region: 0x165, script: 0x57, flags: 0x0}, + 190: {region: 0xe8, script: 0x21, flags: 0x0}, + 191: {region: 0x106, script: 0x1f, flags: 0x0}, + 192: {region: 0x15f, script: 0x57, flags: 0x0}, + 193: {region: 0x165, script: 0x57, flags: 0x0}, + 194: {region: 0x95, script: 0x57, flags: 0x0}, + 195: {region: 0x165, script: 0x57, flags: 0x0}, + 196: {region: 0x52, script: 0x57, flags: 0x0}, + 197: {region: 0x165, script: 0x57, flags: 0x0}, + 198: {region: 0x165, script: 0x57, flags: 0x0}, + 199: {region: 0x165, script: 0x57, flags: 0x0}, + 200: {region: 0x86, script: 0x57, flags: 0x0}, + 201: {region: 0x165, script: 0x57, flags: 0x0}, + 202: {region: 0x165, script: 0x57, flags: 0x0}, + 203: {region: 0x165, script: 0x57, flags: 0x0}, + 204: {region: 0x165, script: 0x57, flags: 0x0}, + 205: {region: 0x6d, script: 0x29, flags: 0x0}, + 206: {region: 0x165, script: 0x57, flags: 0x0}, + 207: {region: 0x165, script: 0x57, flags: 0x0}, + 208: {region: 0x52, script: 0x57, flags: 0x0}, + 209: {region: 0x165, script: 0x57, flags: 0x0}, + 210: {region: 0x165, script: 0x57, flags: 0x0}, + 211: {region: 0xc3, script: 0x57, flags: 0x0}, + 212: {region: 0x165, script: 0x57, flags: 0x0}, + 213: {region: 0x165, script: 0x57, flags: 0x0}, + 214: {region: 0x165, script: 0x57, flags: 0x0}, + 215: {region: 0x6e, script: 0x57, flags: 0x0}, + 216: {region: 0x165, script: 0x57, flags: 0x0}, + 217: {region: 0x165, script: 0x57, flags: 0x0}, + 218: {region: 0xd6, script: 0x57, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x1f, flags: 0x0}, + 221: {region: 0xe7, script: 0x57, flags: 0x0}, + 222: {region: 0x165, script: 0x57, flags: 0x0}, + 223: {region: 0x131, script: 0x57, flags: 0x0}, + 224: {region: 0x8a, script: 0x57, flags: 0x0}, + 225: {region: 0x75, script: 0x57, flags: 0x0}, + 226: {region: 0x106, script: 0x1f, flags: 0x0}, + 227: {region: 0x135, script: 0x57, flags: 0x0}, + 228: {region: 0x49, script: 0x57, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x57, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x57, flags: 0x0}, + 235: {region: 0x165, script: 0x57, flags: 0x0}, + 236: {region: 0x165, script: 0x57, flags: 0x0}, + 237: {region: 0x165, script: 0x57, flags: 0x0}, + 238: {region: 0x165, script: 0x57, flags: 0x0}, + 239: {region: 0xc5, script: 0xcc, flags: 0x0}, + 240: {region: 0x78, script: 0x57, flags: 0x0}, + 241: {region: 0x6b, script: 0x1c, flags: 0x0}, + 242: {region: 0xe7, script: 0x57, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x1f, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x57, flags: 0x0}, + 250: {region: 0x5e, script: 0x57, flags: 0x0}, + 251: {region: 0xe9, script: 0x57, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x81, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x1f, flags: 0x0}, + 256: {region: 0x7b, script: 0x57, flags: 0x0}, + 257: {region: 0x63, script: 0x57, flags: 0x0}, + 258: {region: 0x165, script: 0x57, flags: 0x0}, + 259: {region: 0x165, script: 0x57, flags: 0x0}, + 260: {region: 0x165, script: 0x57, flags: 0x0}, + 261: {region: 0x165, script: 0x57, flags: 0x0}, + 262: {region: 0x135, script: 0x57, flags: 0x0}, + 263: {region: 0x106, script: 0x1f, flags: 0x0}, + 264: {region: 0xa4, script: 0x57, flags: 0x0}, + 265: {region: 0x165, script: 0x57, flags: 0x0}, + 266: {region: 0x165, script: 0x57, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x57, flags: 0x0}, + 269: {region: 0x60, script: 0x57, flags: 0x0}, + 270: {region: 0x165, script: 0x57, flags: 0x0}, + 271: {region: 0x49, script: 0x57, flags: 0x0}, + 272: {region: 0x165, script: 0x57, flags: 0x0}, + 273: {region: 0x165, script: 0x57, flags: 0x0}, + 274: {region: 0x165, script: 0x57, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x57, flags: 0x0}, + 277: {region: 0x165, script: 0x57, flags: 0x0}, + 278: {region: 0x165, script: 0x57, flags: 0x0}, + 279: {region: 0xd4, script: 0x57, flags: 0x0}, + 280: {region: 0x4f, script: 0x57, flags: 0x0}, + 281: {region: 0x165, script: 0x57, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x57, flags: 0x0}, + 284: {region: 0x165, script: 0x57, flags: 0x0}, + 285: {region: 0x165, script: 0x57, flags: 0x0}, + 286: {region: 0x165, script: 0x29, flags: 0x0}, + 287: {region: 0x60, script: 0x57, flags: 0x0}, + 288: {region: 0xc3, script: 0x57, flags: 0x0}, + 289: {region: 0xd0, script: 0x57, flags: 0x0}, + 290: {region: 0x165, script: 0x57, flags: 0x0}, + 291: {region: 0xdb, script: 0x21, flags: 0x0}, + 292: {region: 0x52, script: 0x57, flags: 0x0}, + 293: {region: 0x165, script: 0x57, flags: 0x0}, + 294: {region: 0x165, script: 0x57, flags: 0x0}, + 295: {region: 0x165, script: 0x57, flags: 0x0}, + 296: {region: 0xcd, script: 0xde, flags: 0x0}, + 297: {region: 0x165, script: 0x57, flags: 0x0}, + 298: {region: 0x165, script: 0x57, flags: 0x0}, + 299: {region: 0x114, script: 0x57, flags: 0x0}, + 300: {region: 0x37, script: 0x57, flags: 0x0}, + 301: {region: 0x43, script: 0xe0, flags: 0x0}, + 302: {region: 0x165, script: 0x57, flags: 0x0}, + 303: {region: 0xa4, script: 0x57, flags: 0x0}, + 304: {region: 0x80, script: 0x57, flags: 0x0}, + 305: {region: 0xd6, script: 0x57, flags: 0x0}, + 306: {region: 0x9e, script: 0x57, flags: 0x0}, + 307: {region: 0x6b, script: 0x27, flags: 0x0}, + 308: {region: 0x165, script: 0x57, flags: 0x0}, + 309: {region: 0xc4, script: 0x48, flags: 0x0}, + 310: {region: 0x87, script: 0x31, flags: 0x0}, + 311: {region: 0x165, script: 0x57, flags: 0x0}, + 312: {region: 0x165, script: 0x57, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x57, flags: 0x0}, + 315: {region: 0x165, script: 0x57, flags: 0x0}, + 316: {region: 0x1, script: 0x57, flags: 0x0}, + 317: {region: 0x165, script: 0x57, flags: 0x0}, + 318: {region: 0x6e, script: 0x57, flags: 0x0}, + 319: {region: 0x135, script: 0x57, flags: 0x0}, + 320: {region: 0x6a, script: 0x57, flags: 0x0}, + 321: {region: 0x165, script: 0x57, flags: 0x0}, + 322: {region: 0x9e, script: 0x43, flags: 0x0}, + 323: {region: 0x165, script: 0x57, flags: 0x0}, + 324: {region: 0x165, script: 0x57, flags: 0x0}, + 325: {region: 0x6e, script: 0x57, flags: 0x0}, + 326: {region: 0x52, script: 0x57, flags: 0x0}, + 327: {region: 0x6e, script: 0x57, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x57, flags: 0x0}, + 330: {region: 0x165, script: 0x57, flags: 0x0}, + 331: {region: 0x165, script: 0x57, flags: 0x0}, + 332: {region: 0x165, script: 0x57, flags: 0x0}, + 333: {region: 0x86, script: 0x57, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x57, flags: 0x0}, + 336: {region: 0xc3, script: 0x57, flags: 0x0}, + 337: {region: 0x72, script: 0x57, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x57, flags: 0x0}, + 340: {region: 0x10c, script: 0x57, flags: 0x0}, + 341: {region: 0x73, script: 0x57, flags: 0x0}, + 342: {region: 0x165, script: 0x57, flags: 0x0}, + 343: {region: 0x165, script: 0x57, flags: 0x0}, + 344: {region: 0x76, script: 0x57, flags: 0x0}, + 345: {region: 0x165, script: 0x57, flags: 0x0}, + 346: {region: 0x3b, script: 0x57, flags: 0x0}, + 347: {region: 0x165, script: 0x57, flags: 0x0}, + 348: {region: 0x165, script: 0x57, flags: 0x0}, + 349: {region: 0x165, script: 0x57, flags: 0x0}, + 350: {region: 0x78, script: 0x57, flags: 0x0}, + 351: {region: 0x135, script: 0x57, flags: 0x0}, + 352: {region: 0x78, script: 0x57, flags: 0x0}, + 353: {region: 0x60, script: 0x57, flags: 0x0}, + 354: {region: 0x60, script: 0x57, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x57, flags: 0x0}, + 357: {region: 0x165, script: 0x57, flags: 0x0}, + 358: {region: 0x84, script: 0x57, flags: 0x0}, + 359: {region: 0x165, script: 0x57, flags: 0x0}, + 360: {region: 0xd4, script: 0x57, flags: 0x0}, + 361: {region: 0x9e, script: 0x57, flags: 0x0}, + 362: {region: 0xd6, script: 0x57, flags: 0x0}, + 363: {region: 0x165, script: 0x57, flags: 0x0}, + 364: {region: 0x10b, script: 0x57, flags: 0x0}, + 365: {region: 0xd9, script: 0x57, flags: 0x0}, + 366: {region: 0x96, script: 0x57, flags: 0x0}, + 367: {region: 0x80, script: 0x57, flags: 0x0}, + 368: {region: 0x165, script: 0x57, flags: 0x0}, + 369: {region: 0xbc, script: 0x57, flags: 0x0}, + 370: {region: 0x165, script: 0x57, flags: 0x0}, + 371: {region: 0x165, script: 0x57, flags: 0x0}, + 372: {region: 0x165, script: 0x57, flags: 0x0}, + 373: {region: 0x53, script: 0x38, flags: 0x0}, + 374: {region: 0x165, script: 0x57, flags: 0x0}, + 375: {region: 0x95, script: 0x57, flags: 0x0}, + 376: {region: 0x165, script: 0x57, flags: 0x0}, + 377: {region: 0x165, script: 0x57, flags: 0x0}, + 378: {region: 0x99, script: 0x21, flags: 0x0}, + 379: {region: 0x165, script: 0x57, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x57, flags: 0x0}, + 382: {region: 0x7b, script: 0x57, flags: 0x0}, + 383: {region: 0x165, script: 0x57, flags: 0x0}, + 384: {region: 0x165, script: 0x57, flags: 0x0}, + 385: {region: 0x165, script: 0x57, flags: 0x0}, + 386: {region: 0x165, script: 0x57, flags: 0x0}, + 387: {region: 0x165, script: 0x57, flags: 0x0}, + 388: {region: 0x165, script: 0x57, flags: 0x0}, + 389: {region: 0x6f, script: 0x29, flags: 0x0}, + 390: {region: 0x165, script: 0x57, flags: 0x0}, + 391: {region: 0xdb, script: 0x21, flags: 0x0}, + 392: {region: 0x165, script: 0x57, flags: 0x0}, + 393: {region: 0xa7, script: 0x57, flags: 0x0}, + 394: {region: 0x165, script: 0x57, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x57, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x57, flags: 0x0}, + 399: {region: 0x165, script: 0x57, flags: 0x0}, + 400: {region: 0x6e, script: 0x57, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x57, flags: 0x0}, + 403: {region: 0x165, script: 0x29, flags: 0x0}, + 404: {region: 0xf1, script: 0x57, flags: 0x0}, + 405: {region: 0x165, script: 0x57, flags: 0x0}, + 406: {region: 0x165, script: 0x57, flags: 0x0}, + 407: {region: 0x165, script: 0x57, flags: 0x0}, + 408: {region: 0x165, script: 0x29, flags: 0x0}, + 409: {region: 0x165, script: 0x57, flags: 0x0}, + 410: {region: 0x99, script: 0x21, flags: 0x0}, + 411: {region: 0x99, script: 0xda, flags: 0x0}, + 412: {region: 0x95, script: 0x57, flags: 0x0}, + 413: {region: 0xd9, script: 0x57, flags: 0x0}, + 414: {region: 0x130, script: 0x2f, flags: 0x0}, + 415: {region: 0x165, script: 0x57, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x57, flags: 0x0}, + 419: {region: 0x4e, script: 0x57, flags: 0x0}, + 420: {region: 0x99, script: 0x32, flags: 0x0}, + 421: {region: 0x41, script: 0x57, flags: 0x0}, + 422: {region: 0x54, script: 0x57, flags: 0x0}, + 423: {region: 0x165, script: 0x57, flags: 0x0}, + 424: {region: 0x80, script: 0x57, flags: 0x0}, + 425: {region: 0x165, script: 0x57, flags: 0x0}, + 426: {region: 0x165, script: 0x57, flags: 0x0}, + 427: {region: 0xa4, script: 0x57, flags: 0x0}, + 428: {region: 0x98, script: 0x57, flags: 0x0}, + 429: {region: 0x165, script: 0x57, flags: 0x0}, + 430: {region: 0xdb, script: 0x21, flags: 0x0}, + 431: {region: 0x165, script: 0x57, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x57, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x57, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x57, flags: 0x0}, + 438: {region: 0x53, script: 0x38, flags: 0x0}, + 439: {region: 0x165, script: 0x57, flags: 0x0}, + 440: {region: 0x135, script: 0x57, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x57, flags: 0x0}, + 443: {region: 0x165, script: 0x29, flags: 0x0}, + 444: {region: 0x97, script: 0x3b, flags: 0x0}, + 445: {region: 0x165, script: 0x57, flags: 0x0}, + 446: {region: 0x99, script: 0x21, flags: 0x0}, + 447: {region: 0x165, script: 0x57, flags: 0x0}, + 448: {region: 0x73, script: 0x57, flags: 0x0}, + 449: {region: 0x165, script: 0x57, flags: 0x0}, + 450: {region: 0x165, script: 0x57, flags: 0x0}, + 451: {region: 0xe7, script: 0x57, flags: 0x0}, + 452: {region: 0x165, script: 0x57, flags: 0x0}, + 453: {region: 0x12b, script: 0x3d, flags: 0x0}, + 454: {region: 0x53, script: 0x89, flags: 0x0}, + 455: {region: 0x165, script: 0x57, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x21, flags: 0x0}, + 458: {region: 0xaf, script: 0x3e, flags: 0x0}, + 459: {region: 0xe7, script: 0x57, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x57, flags: 0x0}, + 462: {region: 0x99, script: 0x21, flags: 0x0}, + 463: {region: 0x99, script: 0x21, flags: 0x0}, + 464: {region: 0x165, script: 0x57, flags: 0x0}, + 465: {region: 0x90, script: 0x57, flags: 0x0}, + 466: {region: 0x60, script: 0x57, flags: 0x0}, + 467: {region: 0x53, script: 0x38, flags: 0x0}, + 468: {region: 0x91, script: 0x57, flags: 0x0}, + 469: {region: 0x92, script: 0x57, flags: 0x0}, + 470: {region: 0x165, script: 0x57, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x57, flags: 0x0}, + 473: {region: 0x78, script: 0x57, flags: 0x0}, + 474: {region: 0x165, script: 0x57, flags: 0x0}, + 475: {region: 0x165, script: 0x57, flags: 0x0}, + 476: {region: 0xd0, script: 0x57, flags: 0x0}, + 477: {region: 0xd6, script: 0x57, flags: 0x0}, + 478: {region: 0x165, script: 0x57, flags: 0x0}, + 479: {region: 0x165, script: 0x57, flags: 0x0}, + 480: {region: 0x165, script: 0x57, flags: 0x0}, + 481: {region: 0x95, script: 0x57, flags: 0x0}, + 482: {region: 0x165, script: 0x57, flags: 0x0}, + 483: {region: 0x165, script: 0x57, flags: 0x0}, + 484: {region: 0x165, script: 0x57, flags: 0x0}, + 486: {region: 0x122, script: 0x57, flags: 0x0}, + 487: {region: 0xd6, script: 0x57, flags: 0x0}, + 488: {region: 0x165, script: 0x57, flags: 0x0}, + 489: {region: 0x165, script: 0x57, flags: 0x0}, + 490: {region: 0x53, script: 0xea, flags: 0x0}, + 491: {region: 0x165, script: 0x57, flags: 0x0}, + 492: {region: 0x135, script: 0x57, flags: 0x0}, + 493: {region: 0x165, script: 0x57, flags: 0x0}, + 494: {region: 0x49, script: 0x57, flags: 0x0}, + 495: {region: 0x165, script: 0x57, flags: 0x0}, + 496: {region: 0x165, script: 0x57, flags: 0x0}, + 497: {region: 0xe7, script: 0x57, flags: 0x0}, + 498: {region: 0x165, script: 0x57, flags: 0x0}, + 499: {region: 0x95, script: 0x57, flags: 0x0}, + 500: {region: 0x106, script: 0x1f, flags: 0x0}, + 501: {region: 0x1, script: 0x57, flags: 0x0}, + 502: {region: 0x165, script: 0x57, flags: 0x0}, + 503: {region: 0x165, script: 0x57, flags: 0x0}, + 504: {region: 0x9d, script: 0x57, flags: 0x0}, + 505: {region: 0x9e, script: 0x57, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3b, flags: 0x0}, + 508: {region: 0x165, script: 0x57, flags: 0x0}, + 509: {region: 0x165, script: 0x57, flags: 0x0}, + 510: {region: 0x106, script: 0x57, flags: 0x0}, + 511: {region: 0x165, script: 0x57, flags: 0x0}, + 512: {region: 0xa2, script: 0x46, flags: 0x0}, + 513: {region: 0x165, script: 0x57, flags: 0x0}, + 514: {region: 0xa0, script: 0x57, flags: 0x0}, + 515: {region: 0x1, script: 0x57, flags: 0x0}, + 516: {region: 0x165, script: 0x57, flags: 0x0}, + 517: {region: 0x165, script: 0x57, flags: 0x0}, + 518: {region: 0x165, script: 0x57, flags: 0x0}, + 519: {region: 0x52, script: 0x57, flags: 0x0}, + 520: {region: 0x130, script: 0x3b, flags: 0x0}, + 521: {region: 0x165, script: 0x57, flags: 0x0}, + 522: {region: 0x12f, script: 0x57, flags: 0x0}, + 523: {region: 0xdb, script: 0x21, flags: 0x0}, + 524: {region: 0x165, script: 0x57, flags: 0x0}, + 525: {region: 0x63, script: 0x57, flags: 0x0}, + 526: {region: 0x95, script: 0x57, flags: 0x0}, + 527: {region: 0x95, script: 0x57, flags: 0x0}, + 528: {region: 0x7d, script: 0x2b, flags: 0x0}, + 529: {region: 0x137, script: 0x1f, flags: 0x0}, + 530: {region: 0x67, script: 0x57, flags: 0x0}, + 531: {region: 0xc4, script: 0x57, flags: 0x0}, + 532: {region: 0x165, script: 0x57, flags: 0x0}, + 533: {region: 0x165, script: 0x57, flags: 0x0}, + 534: {region: 0xd6, script: 0x57, flags: 0x0}, + 535: {region: 0xa4, script: 0x57, flags: 0x0}, + 536: {region: 0xc3, script: 0x57, flags: 0x0}, + 537: {region: 0x106, script: 0x1f, flags: 0x0}, + 538: {region: 0x165, script: 0x57, flags: 0x0}, + 539: {region: 0x165, script: 0x57, flags: 0x0}, + 540: {region: 0x165, script: 0x57, flags: 0x0}, + 541: {region: 0x165, script: 0x57, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x57, flags: 0x0}, + 544: {region: 0x164, script: 0x57, flags: 0x0}, + 545: {region: 0x165, script: 0x57, flags: 0x0}, + 546: {region: 0x165, script: 0x57, flags: 0x0}, + 547: {region: 0x12f, script: 0x57, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x57, flags: 0x0}, + 550: {region: 0x123, script: 0xdf, flags: 0x0}, + 551: {region: 0x5a, script: 0x57, flags: 0x0}, + 552: {region: 0x52, script: 0x57, flags: 0x0}, + 553: {region: 0x165, script: 0x57, flags: 0x0}, + 554: {region: 0x4f, script: 0x57, flags: 0x0}, + 555: {region: 0x99, script: 0x21, flags: 0x0}, + 556: {region: 0x99, script: 0x21, flags: 0x0}, + 557: {region: 0x4b, script: 0x57, flags: 0x0}, + 558: {region: 0x95, script: 0x57, flags: 0x0}, + 559: {region: 0x165, script: 0x57, flags: 0x0}, + 560: {region: 0x41, script: 0x57, flags: 0x0}, + 561: {region: 0x99, script: 0x57, flags: 0x0}, + 562: {region: 0x53, script: 0xd6, flags: 0x0}, + 563: {region: 0x99, script: 0x21, flags: 0x0}, + 564: {region: 0xc3, script: 0x57, flags: 0x0}, + 565: {region: 0x165, script: 0x57, flags: 0x0}, + 566: {region: 0x99, script: 0x72, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x57, flags: 0x0}, + 569: {region: 0xa4, script: 0x57, flags: 0x0}, + 570: {region: 0x165, script: 0x57, flags: 0x0}, + 571: {region: 0x12b, script: 0x57, flags: 0x0}, + 572: {region: 0x165, script: 0x57, flags: 0x0}, + 573: {region: 0xd2, script: 0x57, flags: 0x0}, + 574: {region: 0x165, script: 0x57, flags: 0x0}, + 575: {region: 0xaf, script: 0x54, flags: 0x0}, + 576: {region: 0x165, script: 0x57, flags: 0x0}, + 577: {region: 0x165, script: 0x57, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x57, flags: 0x0}, + 580: {region: 0x52, script: 0x57, flags: 0x0}, + 581: {region: 0x82, script: 0x57, flags: 0x0}, + 582: {region: 0xa4, script: 0x57, flags: 0x0}, + 583: {region: 0x165, script: 0x57, flags: 0x0}, + 584: {region: 0x165, script: 0x57, flags: 0x0}, + 585: {region: 0x165, script: 0x57, flags: 0x0}, + 586: {region: 0xa6, script: 0x4b, flags: 0x0}, + 587: {region: 0x2a, script: 0x57, flags: 0x0}, + 588: {region: 0x165, script: 0x57, flags: 0x0}, + 589: {region: 0x165, script: 0x57, flags: 0x0}, + 590: {region: 0x165, script: 0x57, flags: 0x0}, + 591: {region: 0x165, script: 0x57, flags: 0x0}, + 592: {region: 0x165, script: 0x57, flags: 0x0}, + 593: {region: 0x99, script: 0x4f, flags: 0x0}, + 594: {region: 0x8b, script: 0x57, flags: 0x0}, + 595: {region: 0x165, script: 0x57, flags: 0x0}, + 596: {region: 0xab, script: 0x50, flags: 0x0}, + 597: {region: 0x106, script: 0x1f, flags: 0x0}, + 598: {region: 0x99, script: 0x21, flags: 0x0}, + 599: {region: 0x165, script: 0x57, flags: 0x0}, + 600: {region: 0x75, script: 0x57, flags: 0x0}, + 601: {region: 0x165, script: 0x57, flags: 0x0}, + 602: {region: 0xb4, script: 0x57, flags: 0x0}, + 603: {region: 0x165, script: 0x57, flags: 0x0}, + 604: {region: 0x165, script: 0x57, flags: 0x0}, + 605: {region: 0x165, script: 0x57, flags: 0x0}, + 606: {region: 0x165, script: 0x57, flags: 0x0}, + 607: {region: 0x165, script: 0x57, flags: 0x0}, + 608: {region: 0x165, script: 0x57, flags: 0x0}, + 609: {region: 0x165, script: 0x57, flags: 0x0}, + 610: {region: 0x165, script: 0x29, flags: 0x0}, + 611: {region: 0x165, script: 0x57, flags: 0x0}, + 612: {region: 0x106, script: 0x1f, flags: 0x0}, + 613: {region: 0x112, script: 0x57, flags: 0x0}, + 614: {region: 0xe7, script: 0x57, flags: 0x0}, + 615: {region: 0x106, script: 0x57, flags: 0x0}, + 616: {region: 0x165, script: 0x57, flags: 0x0}, + 617: {region: 0x99, script: 0x21, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x57, flags: 0x0}, + 620: {region: 0x165, script: 0x57, flags: 0x0}, + 621: {region: 0x52, script: 0x57, flags: 0x0}, + 622: {region: 0x60, script: 0x57, flags: 0x0}, + 623: {region: 0x165, script: 0x57, flags: 0x0}, + 624: {region: 0x165, script: 0x57, flags: 0x0}, + 625: {region: 0x165, script: 0x29, flags: 0x0}, + 626: {region: 0x165, script: 0x57, flags: 0x0}, + 627: {region: 0x165, script: 0x57, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x57, flags: 0x0}, + 630: {region: 0x165, script: 0x57, flags: 0x0}, + 631: {region: 0x165, script: 0x57, flags: 0x0}, + 632: {region: 0x165, script: 0x57, flags: 0x0}, + 633: {region: 0x106, script: 0x1f, flags: 0x0}, + 634: {region: 0x165, script: 0x57, flags: 0x0}, + 635: {region: 0x165, script: 0x57, flags: 0x0}, + 636: {region: 0x165, script: 0x57, flags: 0x0}, + 637: {region: 0x106, script: 0x1f, flags: 0x0}, + 638: {region: 0x165, script: 0x57, flags: 0x0}, + 639: {region: 0x95, script: 0x57, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x57, flags: 0x0}, + 642: {region: 0x165, script: 0x57, flags: 0x0}, + 643: {region: 0x165, script: 0x57, flags: 0x0}, + 644: {region: 0x165, script: 0x57, flags: 0x0}, + 645: {region: 0x165, script: 0x29, flags: 0x0}, + 646: {region: 0x123, script: 0xdf, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x57, flags: 0x0}, + 649: {region: 0x165, script: 0x57, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x57, flags: 0x0}, + 652: {region: 0x165, script: 0x57, flags: 0x0}, + 653: {region: 0x165, script: 0x57, flags: 0x0}, + 654: {region: 0x138, script: 0x57, flags: 0x0}, + 655: {region: 0x87, script: 0x5b, flags: 0x0}, + 656: {region: 0x97, script: 0x3b, flags: 0x0}, + 657: {region: 0x12f, script: 0x57, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x57, flags: 0x0}, + 660: {region: 0x165, script: 0x57, flags: 0x0}, + 661: {region: 0xb7, script: 0x57, flags: 0x0}, + 662: {region: 0x106, script: 0x1f, flags: 0x0}, + 663: {region: 0x165, script: 0x57, flags: 0x0}, + 664: {region: 0x95, script: 0x57, flags: 0x0}, + 665: {region: 0x165, script: 0x57, flags: 0x0}, + 666: {region: 0x53, script: 0xdf, flags: 0x0}, + 667: {region: 0x165, script: 0x57, flags: 0x0}, + 668: {region: 0x165, script: 0x57, flags: 0x0}, + 669: {region: 0x165, script: 0x57, flags: 0x0}, + 670: {region: 0x165, script: 0x57, flags: 0x0}, + 671: {region: 0x99, script: 0x59, flags: 0x0}, + 672: {region: 0x165, script: 0x57, flags: 0x0}, + 673: {region: 0x165, script: 0x57, flags: 0x0}, + 674: {region: 0x106, script: 0x1f, flags: 0x0}, + 675: {region: 0x131, script: 0x57, flags: 0x0}, + 676: {region: 0x165, script: 0x57, flags: 0x0}, + 677: {region: 0xd9, script: 0x57, flags: 0x0}, + 678: {region: 0x165, script: 0x57, flags: 0x0}, + 679: {region: 0x165, script: 0x57, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x57, flags: 0x0}, + 682: {region: 0x165, script: 0x57, flags: 0x0}, + 683: {region: 0x9e, script: 0x57, flags: 0x0}, + 684: {region: 0x53, script: 0x5d, flags: 0x0}, + 685: {region: 0x95, script: 0x57, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x57, flags: 0x0}, + 688: {region: 0x165, script: 0x57, flags: 0x0}, + 689: {region: 0x165, script: 0x57, flags: 0x0}, + 690: {region: 0x99, script: 0xda, flags: 0x0}, + 691: {region: 0x9e, script: 0x57, flags: 0x0}, + 692: {region: 0x165, script: 0x57, flags: 0x0}, + 693: {region: 0x4b, script: 0x57, flags: 0x0}, + 694: {region: 0x165, script: 0x57, flags: 0x0}, + 695: {region: 0x165, script: 0x57, flags: 0x0}, + 696: {region: 0xaf, script: 0x54, flags: 0x0}, + 697: {region: 0x165, script: 0x57, flags: 0x0}, + 698: {region: 0x165, script: 0x57, flags: 0x0}, + 699: {region: 0x4b, script: 0x57, flags: 0x0}, + 700: {region: 0x165, script: 0x57, flags: 0x0}, + 701: {region: 0x165, script: 0x57, flags: 0x0}, + 702: {region: 0x162, script: 0x57, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x57, flags: 0x0}, + 705: {region: 0xb8, script: 0x57, flags: 0x0}, + 706: {region: 0x4b, script: 0x57, flags: 0x0}, + 707: {region: 0x4b, script: 0x57, flags: 0x0}, + 708: {region: 0xa4, script: 0x57, flags: 0x0}, + 709: {region: 0xa4, script: 0x57, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x57, flags: 0x0}, + 712: {region: 0x123, script: 0xdf, flags: 0x0}, + 713: {region: 0x53, script: 0x38, flags: 0x0}, + 714: {region: 0x12b, script: 0x57, flags: 0x0}, + 715: {region: 0x95, script: 0x57, flags: 0x0}, + 716: {region: 0x52, script: 0x57, flags: 0x0}, + 717: {region: 0x99, script: 0x21, flags: 0x0}, + 718: {region: 0x99, script: 0x21, flags: 0x0}, + 719: {region: 0x95, script: 0x57, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x57, flags: 0x0}, + 722: {region: 0x165, script: 0x57, flags: 0x0}, + 723: {region: 0xcf, script: 0x57, flags: 0x0}, + 724: {region: 0x165, script: 0x57, flags: 0x0}, + 725: {region: 0x165, script: 0x57, flags: 0x0}, + 726: {region: 0x165, script: 0x57, flags: 0x0}, + 727: {region: 0x165, script: 0x57, flags: 0x0}, + 728: {region: 0x165, script: 0x57, flags: 0x0}, + 729: {region: 0x165, script: 0x57, flags: 0x0}, + 730: {region: 0x165, script: 0x57, flags: 0x0}, + 731: {region: 0x165, script: 0x57, flags: 0x0}, + 732: {region: 0x165, script: 0x57, flags: 0x0}, + 733: {region: 0x165, script: 0x57, flags: 0x0}, + 734: {region: 0x165, script: 0x57, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x1f, flags: 0x0}, + 737: {region: 0xe7, script: 0x57, flags: 0x0}, + 738: {region: 0x165, script: 0x57, flags: 0x0}, + 739: {region: 0x95, script: 0x57, flags: 0x0}, + 740: {region: 0x165, script: 0x29, flags: 0x0}, + 741: {region: 0x165, script: 0x57, flags: 0x0}, + 742: {region: 0x165, script: 0x57, flags: 0x0}, + 743: {region: 0x165, script: 0x57, flags: 0x0}, + 744: {region: 0x112, script: 0x57, flags: 0x0}, + 745: {region: 0xa4, script: 0x57, flags: 0x0}, + 746: {region: 0x165, script: 0x57, flags: 0x0}, + 747: {region: 0x165, script: 0x57, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x57, flags: 0x0}, + 750: {region: 0x165, script: 0x57, flags: 0x0}, + 751: {region: 0x165, script: 0x57, flags: 0x0}, + 752: {region: 0x165, script: 0x57, flags: 0x0}, + 753: {region: 0xbf, script: 0x57, flags: 0x0}, + 754: {region: 0xd1, script: 0x57, flags: 0x0}, + 755: {region: 0x165, script: 0x57, flags: 0x0}, + 756: {region: 0x52, script: 0x57, flags: 0x0}, + 757: {region: 0xdb, script: 0x21, flags: 0x0}, + 758: {region: 0x12f, script: 0x57, flags: 0x0}, + 759: {region: 0xc0, script: 0x57, flags: 0x0}, + 760: {region: 0x165, script: 0x57, flags: 0x0}, + 761: {region: 0x165, script: 0x57, flags: 0x0}, + 762: {region: 0xe0, script: 0x57, flags: 0x0}, + 763: {region: 0x165, script: 0x57, flags: 0x0}, + 764: {region: 0x95, script: 0x57, flags: 0x0}, + 765: {region: 0x9b, script: 0x3a, flags: 0x0}, + 766: {region: 0x165, script: 0x57, flags: 0x0}, + 767: {region: 0xc2, script: 0x1f, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x57, flags: 0x0}, + 770: {region: 0x165, script: 0x57, flags: 0x0}, + 771: {region: 0x165, script: 0x57, flags: 0x0}, + 772: {region: 0x99, script: 0x6b, flags: 0x0}, + 773: {region: 0x165, script: 0x57, flags: 0x0}, + 774: {region: 0x165, script: 0x57, flags: 0x0}, + 775: {region: 0x10b, script: 0x57, flags: 0x0}, + 776: {region: 0x165, script: 0x57, flags: 0x0}, + 777: {region: 0x165, script: 0x57, flags: 0x0}, + 778: {region: 0x165, script: 0x57, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x57, flags: 0x0}, + 781: {region: 0x165, script: 0x57, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x72, flags: 0x0}, + 785: {region: 0x165, script: 0x57, flags: 0x0}, + 786: {region: 0x49, script: 0x57, flags: 0x0}, + 787: {region: 0x49, script: 0x57, flags: 0x0}, + 788: {region: 0x37, script: 0x57, flags: 0x0}, + 789: {region: 0x165, script: 0x57, flags: 0x0}, + 790: {region: 0x165, script: 0x57, flags: 0x0}, + 791: {region: 0x165, script: 0x57, flags: 0x0}, + 792: {region: 0x165, script: 0x57, flags: 0x0}, + 793: {region: 0x165, script: 0x57, flags: 0x0}, + 794: {region: 0x165, script: 0x57, flags: 0x0}, + 795: {region: 0x99, script: 0x21, flags: 0x0}, + 796: {region: 0xdb, script: 0x21, flags: 0x0}, + 797: {region: 0x106, script: 0x1f, flags: 0x0}, + 798: {region: 0x35, script: 0x6f, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x57, flags: 0x0}, + 801: {region: 0x165, script: 0x57, flags: 0x0}, + 802: {region: 0x165, script: 0x57, flags: 0x0}, + 803: {region: 0x165, script: 0x57, flags: 0x0}, + 804: {region: 0x99, script: 0x21, flags: 0x0}, + 805: {region: 0x52, script: 0x57, flags: 0x0}, + 807: {region: 0x165, script: 0x57, flags: 0x0}, + 808: {region: 0x135, script: 0x57, flags: 0x0}, + 809: {region: 0x165, script: 0x57, flags: 0x0}, + 810: {region: 0x165, script: 0x57, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x57, flags: 0x0}, + 813: {region: 0x99, script: 0x21, flags: 0x0}, + 814: {region: 0x95, script: 0x57, flags: 0x0}, + 815: {region: 0x164, script: 0x57, flags: 0x0}, + 816: {region: 0x165, script: 0x57, flags: 0x0}, + 817: {region: 0xc4, script: 0x72, flags: 0x0}, + 818: {region: 0x165, script: 0x57, flags: 0x0}, + 819: {region: 0x165, script: 0x29, flags: 0x0}, + 820: {region: 0x106, script: 0x1f, flags: 0x0}, + 821: {region: 0x165, script: 0x57, flags: 0x0}, + 822: {region: 0x131, script: 0x57, flags: 0x0}, + 823: {region: 0x9c, script: 0x63, flags: 0x0}, + 824: {region: 0x165, script: 0x57, flags: 0x0}, + 825: {region: 0x165, script: 0x57, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x57, flags: 0x0}, + 828: {region: 0x165, script: 0x57, flags: 0x0}, + 829: {region: 0x165, script: 0x57, flags: 0x0}, + 830: {region: 0xdd, script: 0x57, flags: 0x0}, + 831: {region: 0x165, script: 0x57, flags: 0x0}, + 832: {region: 0x165, script: 0x57, flags: 0x0}, + 834: {region: 0x165, script: 0x57, flags: 0x0}, + 835: {region: 0x53, script: 0x38, flags: 0x0}, + 836: {region: 0x9e, script: 0x57, flags: 0x0}, + 837: {region: 0xd2, script: 0x57, flags: 0x0}, + 838: {region: 0x165, script: 0x57, flags: 0x0}, + 839: {region: 0xda, script: 0x57, flags: 0x0}, + 840: {region: 0x165, script: 0x57, flags: 0x0}, + 841: {region: 0x165, script: 0x57, flags: 0x0}, + 842: {region: 0x165, script: 0x57, flags: 0x0}, + 843: {region: 0xcf, script: 0x57, flags: 0x0}, + 844: {region: 0x165, script: 0x57, flags: 0x0}, + 845: {region: 0x165, script: 0x57, flags: 0x0}, + 846: {region: 0x164, script: 0x57, flags: 0x0}, + 847: {region: 0xd1, script: 0x57, flags: 0x0}, + 848: {region: 0x60, script: 0x57, flags: 0x0}, + 849: {region: 0xdb, script: 0x21, flags: 0x0}, + 850: {region: 0x165, script: 0x57, flags: 0x0}, + 851: {region: 0xdb, script: 0x21, flags: 0x0}, + 852: {region: 0x165, script: 0x57, flags: 0x0}, + 853: {region: 0x165, script: 0x57, flags: 0x0}, + 854: {region: 0xd2, script: 0x57, flags: 0x0}, + 855: {region: 0x165, script: 0x57, flags: 0x0}, + 856: {region: 0x165, script: 0x57, flags: 0x0}, + 857: {region: 0xd1, script: 0x57, flags: 0x0}, + 858: {region: 0x165, script: 0x57, flags: 0x0}, + 859: {region: 0xcf, script: 0x57, flags: 0x0}, + 860: {region: 0xcf, script: 0x57, flags: 0x0}, + 861: {region: 0x165, script: 0x57, flags: 0x0}, + 862: {region: 0x165, script: 0x57, flags: 0x0}, + 863: {region: 0x95, script: 0x57, flags: 0x0}, + 864: {region: 0x165, script: 0x57, flags: 0x0}, + 865: {region: 0xdf, script: 0x57, flags: 0x0}, + 866: {region: 0x165, script: 0x57, flags: 0x0}, + 867: {region: 0x165, script: 0x57, flags: 0x0}, + 868: {region: 0x99, script: 0x57, flags: 0x0}, + 869: {region: 0x165, script: 0x57, flags: 0x0}, + 870: {region: 0x165, script: 0x57, flags: 0x0}, + 871: {region: 0xd9, script: 0x57, flags: 0x0}, + 872: {region: 0x52, script: 0x57, flags: 0x0}, + 873: {region: 0x165, script: 0x57, flags: 0x0}, + 874: {region: 0xda, script: 0x57, flags: 0x0}, + 875: {region: 0x165, script: 0x57, flags: 0x0}, + 876: {region: 0x52, script: 0x57, flags: 0x0}, + 877: {region: 0x165, script: 0x57, flags: 0x0}, + 878: {region: 0x165, script: 0x57, flags: 0x0}, + 879: {region: 0xda, script: 0x57, flags: 0x0}, + 880: {region: 0x123, script: 0x53, flags: 0x0}, + 881: {region: 0x99, script: 0x21, flags: 0x0}, + 882: {region: 0x10c, script: 0xbf, flags: 0x0}, + 883: {region: 0x165, script: 0x57, flags: 0x0}, + 884: {region: 0x165, script: 0x57, flags: 0x0}, + 885: {region: 0x84, script: 0x78, flags: 0x0}, + 886: {region: 0x161, script: 0x57, flags: 0x0}, + 887: {region: 0x165, script: 0x57, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x57, flags: 0x0}, + 890: {region: 0x161, script: 0x57, flags: 0x0}, + 891: {region: 0x165, script: 0x57, flags: 0x0}, + 892: {region: 0x165, script: 0x57, flags: 0x0}, + 893: {region: 0x165, script: 0x57, flags: 0x0}, + 894: {region: 0x165, script: 0x57, flags: 0x0}, + 895: {region: 0x165, script: 0x57, flags: 0x0}, + 896: {region: 0x117, script: 0x57, flags: 0x0}, + 897: {region: 0x165, script: 0x57, flags: 0x0}, + 898: {region: 0x165, script: 0x57, flags: 0x0}, + 899: {region: 0x135, script: 0x57, flags: 0x0}, + 900: {region: 0x165, script: 0x57, flags: 0x0}, + 901: {region: 0x53, script: 0x57, flags: 0x0}, + 902: {region: 0x165, script: 0x57, flags: 0x0}, + 903: {region: 0xce, script: 0x57, flags: 0x0}, + 904: {region: 0x12f, script: 0x57, flags: 0x0}, + 905: {region: 0x131, script: 0x57, flags: 0x0}, + 906: {region: 0x80, script: 0x57, flags: 0x0}, + 907: {region: 0x78, script: 0x57, flags: 0x0}, + 908: {region: 0x165, script: 0x57, flags: 0x0}, + 910: {region: 0x165, script: 0x57, flags: 0x0}, + 911: {region: 0x165, script: 0x57, flags: 0x0}, + 912: {region: 0x6f, script: 0x57, flags: 0x0}, + 913: {region: 0x165, script: 0x57, flags: 0x0}, + 914: {region: 0x165, script: 0x57, flags: 0x0}, + 915: {region: 0x165, script: 0x57, flags: 0x0}, + 916: {region: 0x165, script: 0x57, flags: 0x0}, + 917: {region: 0x99, script: 0x7d, flags: 0x0}, + 918: {region: 0x165, script: 0x57, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x1f, flags: 0x0}, + 921: {region: 0x135, script: 0x7e, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x7c, flags: 0x0}, + 924: {region: 0x165, script: 0x57, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x57, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x57, flags: 0x0}, + 929: {region: 0x30, script: 0x57, flags: 0x0}, + 930: {region: 0xf0, script: 0x57, flags: 0x0}, + 931: {region: 0x165, script: 0x57, flags: 0x0}, + 932: {region: 0x78, script: 0x57, flags: 0x0}, + 933: {region: 0xd6, script: 0x57, flags: 0x0}, + 934: {region: 0x135, script: 0x57, flags: 0x0}, + 935: {region: 0x49, script: 0x57, flags: 0x0}, + 936: {region: 0x165, script: 0x57, flags: 0x0}, + 937: {region: 0x9c, script: 0xe8, flags: 0x0}, + 938: {region: 0x165, script: 0x57, flags: 0x0}, + 939: {region: 0x60, script: 0x57, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x87, flags: 0x0}, + 943: {region: 0x165, script: 0x57, flags: 0x0}, + 944: {region: 0x165, script: 0x57, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x57, flags: 0x0}, + 947: {region: 0xe9, script: 0x57, flags: 0x0}, + 948: {region: 0x165, script: 0x57, flags: 0x0}, + 949: {region: 0x9e, script: 0x57, flags: 0x0}, + 950: {region: 0x165, script: 0x57, flags: 0x0}, + 951: {region: 0x165, script: 0x57, flags: 0x0}, + 952: {region: 0x87, script: 0x31, flags: 0x0}, + 953: {region: 0x75, script: 0x57, flags: 0x0}, + 954: {region: 0x165, script: 0x57, flags: 0x0}, + 955: {region: 0xe8, script: 0x4a, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x57, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x57, flags: 0x0}, + 960: {region: 0x41, script: 0x57, flags: 0x0}, + 961: {region: 0x165, script: 0x57, flags: 0x0}, + 962: {region: 0x7a, script: 0x57, flags: 0x0}, + 963: {region: 0x165, script: 0x57, flags: 0x0}, + 964: {region: 0xe4, script: 0x57, flags: 0x0}, + 965: {region: 0x89, script: 0x57, flags: 0x0}, + 966: {region: 0x69, script: 0x57, flags: 0x0}, + 967: {region: 0x165, script: 0x57, flags: 0x0}, + 968: {region: 0x99, script: 0x21, flags: 0x0}, + 969: {region: 0x165, script: 0x57, flags: 0x0}, + 970: {region: 0x102, script: 0x57, flags: 0x0}, + 971: {region: 0x95, script: 0x57, flags: 0x0}, + 972: {region: 0x165, script: 0x57, flags: 0x0}, + 973: {region: 0x165, script: 0x57, flags: 0x0}, + 974: {region: 0x9e, script: 0x57, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x57, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x21, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x57, flags: 0x0}, + 981: {region: 0x72, script: 0x57, flags: 0x0}, + 982: {region: 0x4e, script: 0x57, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x57, flags: 0x0}, + 985: {region: 0x3a, script: 0x57, flags: 0x0}, + 986: {region: 0x165, script: 0x57, flags: 0x0}, + 987: {region: 0xd1, script: 0x57, flags: 0x0}, + 988: {region: 0x104, script: 0x57, flags: 0x0}, + 989: {region: 0x95, script: 0x57, flags: 0x0}, + 990: {region: 0x12f, script: 0x57, flags: 0x0}, + 991: {region: 0x165, script: 0x57, flags: 0x0}, + 992: {region: 0x165, script: 0x57, flags: 0x0}, + 993: {region: 0x73, script: 0x57, flags: 0x0}, + 994: {region: 0x106, script: 0x1f, flags: 0x0}, + 995: {region: 0x130, script: 0x1f, flags: 0x0}, + 996: {region: 0x109, script: 0x57, flags: 0x0}, + 997: {region: 0x107, script: 0x57, flags: 0x0}, + 998: {region: 0x12f, script: 0x57, flags: 0x0}, + 999: {region: 0x165, script: 0x57, flags: 0x0}, + 1000: {region: 0xa2, script: 0x49, flags: 0x0}, + 1001: {region: 0x99, script: 0x21, flags: 0x0}, + 1002: {region: 0x80, script: 0x57, flags: 0x0}, + 1003: {region: 0x106, script: 0x1f, flags: 0x0}, + 1004: {region: 0xa4, script: 0x57, flags: 0x0}, + 1005: {region: 0x95, script: 0x57, flags: 0x0}, + 1006: {region: 0x99, script: 0x57, flags: 0x0}, + 1007: {region: 0x114, script: 0x57, flags: 0x0}, + 1008: {region: 0x99, script: 0xc3, flags: 0x0}, + 1009: {region: 0x165, script: 0x57, flags: 0x0}, + 1010: {region: 0x165, script: 0x57, flags: 0x0}, + 1011: {region: 0x12f, script: 0x57, flags: 0x0}, + 1012: {region: 0x9e, script: 0x57, flags: 0x0}, + 1013: {region: 0x99, script: 0x21, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x57, flags: 0x0}, + 1016: {region: 0x7b, script: 0x57, flags: 0x0}, + 1017: {region: 0x49, script: 0x57, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x57, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x57, flags: 0x0}, + 1022: {region: 0x4f, script: 0x57, flags: 0x0}, + 1023: {region: 0xd1, script: 0x57, flags: 0x0}, + 1024: {region: 0xcf, script: 0x57, flags: 0x0}, + 1025: {region: 0xc3, script: 0x57, flags: 0x0}, + 1026: {region: 0x4c, script: 0x57, flags: 0x0}, + 1027: {region: 0x96, script: 0x7a, flags: 0x0}, + 1028: {region: 0xb6, script: 0x57, flags: 0x0}, + 1029: {region: 0x165, script: 0x29, flags: 0x0}, + 1030: {region: 0x165, script: 0x57, flags: 0x0}, + 1032: {region: 0xba, script: 0xdc, flags: 0x0}, + 1033: {region: 0x165, script: 0x57, flags: 0x0}, + 1034: {region: 0xc4, script: 0x72, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xca, flags: 0x0}, + 1037: {region: 0x6f, script: 0x57, flags: 0x0}, + 1038: {region: 0x165, script: 0x57, flags: 0x0}, + 1039: {region: 0x165, script: 0x57, flags: 0x0}, + 1040: {region: 0x165, script: 0x57, flags: 0x0}, + 1041: {region: 0x165, script: 0x57, flags: 0x0}, + 1042: {region: 0x111, script: 0x57, flags: 0x0}, + 1043: {region: 0x165, script: 0x57, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x57, flags: 0x0}, + 1046: {region: 0x10f, script: 0x57, flags: 0x0}, + 1047: {region: 0x165, script: 0x57, flags: 0x0}, + 1048: {region: 0xe9, script: 0x57, flags: 0x0}, + 1049: {region: 0x165, script: 0x57, flags: 0x0}, + 1050: {region: 0x95, script: 0x57, flags: 0x0}, + 1051: {region: 0x142, script: 0x57, flags: 0x0}, + 1052: {region: 0x10c, script: 0x57, flags: 0x0}, + 1054: {region: 0x10c, script: 0x57, flags: 0x0}, + 1055: {region: 0x72, script: 0x57, flags: 0x0}, + 1056: {region: 0x97, script: 0xc0, flags: 0x0}, + 1057: {region: 0x165, script: 0x57, flags: 0x0}, + 1058: {region: 0x72, script: 0x57, flags: 0x0}, + 1059: {region: 0x164, script: 0x57, flags: 0x0}, + 1060: {region: 0x165, script: 0x57, flags: 0x0}, + 1061: {region: 0xc3, script: 0x57, flags: 0x0}, + 1062: {region: 0x165, script: 0x57, flags: 0x0}, + 1063: {region: 0x165, script: 0x57, flags: 0x0}, + 1064: {region: 0x165, script: 0x57, flags: 0x0}, + 1065: {region: 0x115, script: 0x57, flags: 0x0}, + 1066: {region: 0x165, script: 0x57, flags: 0x0}, + 1067: {region: 0x165, script: 0x57, flags: 0x0}, + 1068: {region: 0x123, script: 0xdf, flags: 0x0}, + 1069: {region: 0x165, script: 0x57, flags: 0x0}, + 1070: {region: 0x165, script: 0x57, flags: 0x0}, + 1071: {region: 0x165, script: 0x57, flags: 0x0}, + 1072: {region: 0x165, script: 0x57, flags: 0x0}, + 1073: {region: 0x27, script: 0x57, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xcb, flags: 0x0}, + 1076: {region: 0x116, script: 0x57, flags: 0x0}, + 1077: {region: 0x114, script: 0x57, flags: 0x0}, + 1078: {region: 0x99, script: 0x21, flags: 0x0}, + 1079: {region: 0x161, script: 0x57, flags: 0x0}, + 1080: {region: 0x165, script: 0x57, flags: 0x0}, + 1081: {region: 0x165, script: 0x57, flags: 0x0}, + 1082: {region: 0x6d, script: 0x57, flags: 0x0}, + 1083: {region: 0x161, script: 0x57, flags: 0x0}, + 1084: {region: 0x165, script: 0x57, flags: 0x0}, + 1085: {region: 0x60, script: 0x57, flags: 0x0}, + 1086: {region: 0x95, script: 0x57, flags: 0x0}, + 1087: {region: 0x165, script: 0x57, flags: 0x0}, + 1088: {region: 0x165, script: 0x57, flags: 0x0}, + 1089: {region: 0x12f, script: 0x57, flags: 0x0}, + 1090: {region: 0x165, script: 0x57, flags: 0x0}, + 1091: {region: 0x84, script: 0x57, flags: 0x0}, + 1092: {region: 0x10c, script: 0x57, flags: 0x0}, + 1093: {region: 0x12f, script: 0x57, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x57, flags: 0x0}, + 1096: {region: 0x60, script: 0x57, flags: 0x0}, + 1097: {region: 0x165, script: 0x57, flags: 0x0}, + 1098: {region: 0x99, script: 0x21, flags: 0x0}, + 1099: {region: 0x95, script: 0x57, flags: 0x0}, + 1100: {region: 0x165, script: 0x57, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, + 1103: {region: 0xe9, script: 0x57, flags: 0x0}, + 1104: {region: 0x99, script: 0xd7, flags: 0x0}, + 1105: {region: 0xdb, script: 0x21, flags: 0x0}, + 1106: {region: 0x165, script: 0x57, flags: 0x0}, + 1107: {region: 0x165, script: 0x57, flags: 0x0}, + 1108: {region: 0x165, script: 0x57, flags: 0x0}, + 1109: {region: 0x165, script: 0x57, flags: 0x0}, + 1110: {region: 0x165, script: 0x57, flags: 0x0}, + 1111: {region: 0x165, script: 0x57, flags: 0x0}, + 1112: {region: 0x165, script: 0x57, flags: 0x0}, + 1113: {region: 0x165, script: 0x57, flags: 0x0}, + 1114: {region: 0xe7, script: 0x57, flags: 0x0}, + 1115: {region: 0x165, script: 0x57, flags: 0x0}, + 1116: {region: 0x165, script: 0x57, flags: 0x0}, + 1117: {region: 0x99, script: 0x4f, flags: 0x0}, + 1118: {region: 0x53, script: 0xd5, flags: 0x0}, + 1119: {region: 0xdb, script: 0x21, flags: 0x0}, + 1120: {region: 0xdb, script: 0x21, flags: 0x0}, + 1121: {region: 0x99, script: 0xda, flags: 0x0}, + 1122: {region: 0x165, script: 0x57, flags: 0x0}, + 1123: {region: 0x112, script: 0x57, flags: 0x0}, + 1124: {region: 0x131, script: 0x57, flags: 0x0}, + 1125: {region: 0x126, script: 0x57, flags: 0x0}, + 1126: {region: 0x165, script: 0x57, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x57, flags: 0x0}, + 1129: {region: 0x165, script: 0x57, flags: 0x0}, + 1130: {region: 0x165, script: 0x57, flags: 0x0}, + 1131: {region: 0x123, script: 0xdf, flags: 0x0}, + 1132: {region: 0xdb, script: 0x21, flags: 0x0}, + 1133: {region: 0xdb, script: 0x21, flags: 0x0}, + 1134: {region: 0xdb, script: 0x21, flags: 0x0}, + 1135: {region: 0x6f, script: 0x29, flags: 0x0}, + 1136: {region: 0x165, script: 0x57, flags: 0x0}, + 1137: {region: 0x6d, script: 0x29, flags: 0x0}, + 1138: {region: 0x165, script: 0x57, flags: 0x0}, + 1139: {region: 0x165, script: 0x57, flags: 0x0}, + 1140: {region: 0x165, script: 0x57, flags: 0x0}, + 1141: {region: 0xd6, script: 0x57, flags: 0x0}, + 1142: {region: 0x127, script: 0x57, flags: 0x0}, + 1143: {region: 0x125, script: 0x57, flags: 0x0}, + 1144: {region: 0x32, script: 0x57, flags: 0x0}, + 1145: {region: 0xdb, script: 0x21, flags: 0x0}, + 1146: {region: 0xe7, script: 0x57, flags: 0x0}, + 1147: {region: 0x165, script: 0x57, flags: 0x0}, + 1148: {region: 0x165, script: 0x57, flags: 0x0}, + 1149: {region: 0x32, script: 0x57, flags: 0x0}, + 1150: {region: 0xd4, script: 0x57, flags: 0x0}, + 1151: {region: 0x165, script: 0x57, flags: 0x0}, + 1152: {region: 0x161, script: 0x57, flags: 0x0}, + 1153: {region: 0x165, script: 0x57, flags: 0x0}, + 1154: {region: 0x129, script: 0x57, flags: 0x0}, + 1155: {region: 0x165, script: 0x57, flags: 0x0}, + 1156: {region: 0xce, script: 0x57, flags: 0x0}, + 1157: {region: 0x165, script: 0x57, flags: 0x0}, + 1158: {region: 0xe6, script: 0x57, flags: 0x0}, + 1159: {region: 0x165, script: 0x57, flags: 0x0}, + 1160: {region: 0x165, script: 0x57, flags: 0x0}, + 1161: {region: 0x165, script: 0x57, flags: 0x0}, + 1162: {region: 0x12b, script: 0x57, flags: 0x0}, + 1163: {region: 0x12b, script: 0x57, flags: 0x0}, + 1164: {region: 0x12e, script: 0x57, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x57, flags: 0x0}, + 1167: {region: 0x87, script: 0x31, flags: 0x0}, + 1168: {region: 0xdb, script: 0x21, flags: 0x0}, + 1169: {region: 0xe7, script: 0x57, flags: 0x0}, + 1170: {region: 0x43, script: 0xe0, flags: 0x0}, + 1171: {region: 0x165, script: 0x57, flags: 0x0}, + 1172: {region: 0x106, script: 0x1f, flags: 0x0}, + 1173: {region: 0x165, script: 0x57, flags: 0x0}, + 1174: {region: 0x165, script: 0x57, flags: 0x0}, + 1175: {region: 0x131, script: 0x57, flags: 0x0}, + 1176: {region: 0x165, script: 0x57, flags: 0x0}, + 1177: {region: 0x123, script: 0xdf, flags: 0x0}, + 1178: {region: 0x32, script: 0x57, flags: 0x0}, + 1179: {region: 0x165, script: 0x57, flags: 0x0}, + 1180: {region: 0x165, script: 0x57, flags: 0x0}, + 1181: {region: 0xce, script: 0x57, flags: 0x0}, + 1182: {region: 0x165, script: 0x57, flags: 0x0}, + 1183: {region: 0x165, script: 0x57, flags: 0x0}, + 1184: {region: 0x12d, script: 0x57, flags: 0x0}, + 1185: {region: 0x165, script: 0x57, flags: 0x0}, + 1187: {region: 0x165, script: 0x57, flags: 0x0}, + 1188: {region: 0xd4, script: 0x57, flags: 0x0}, + 1189: {region: 0x53, script: 0xd8, flags: 0x0}, + 1190: {region: 0xe5, script: 0x57, flags: 0x0}, + 1191: {region: 0x165, script: 0x57, flags: 0x0}, + 1192: {region: 0x106, script: 0x1f, flags: 0x0}, + 1193: {region: 0xba, script: 0x57, flags: 0x0}, + 1194: {region: 0x165, script: 0x57, flags: 0x0}, + 1195: {region: 0x106, script: 0x1f, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, + 1198: {region: 0x130, script: 0x1f, flags: 0x0}, + 1199: {region: 0x75, script: 0x57, flags: 0x0}, + 1200: {region: 0x2a, script: 0x57, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x57, flags: 0x0}, + 1206: {region: 0x165, script: 0x57, flags: 0x0}, + 1207: {region: 0x165, script: 0x57, flags: 0x0}, + 1208: {region: 0x165, script: 0x57, flags: 0x0}, + 1209: {region: 0x165, script: 0x57, flags: 0x0}, + 1210: {region: 0x165, script: 0x57, flags: 0x0}, + 1211: {region: 0x165, script: 0x57, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x57, flags: 0x0}, + 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, + 1215: {region: 0x165, script: 0x57, flags: 0x0}, + 1216: {region: 0x161, script: 0x57, flags: 0x0}, + 1217: {region: 0x9e, script: 0x57, flags: 0x0}, + 1218: {region: 0x106, script: 0x57, flags: 0x0}, + 1219: {region: 0x13e, script: 0x57, flags: 0x0}, + 1220: {region: 0x11b, script: 0x57, flags: 0x0}, + 1221: {region: 0x165, script: 0x57, flags: 0x0}, + 1222: {region: 0x36, script: 0x57, flags: 0x0}, + 1223: {region: 0x60, script: 0x57, flags: 0x0}, + 1224: {region: 0xd1, script: 0x57, flags: 0x0}, + 1225: {region: 0x1, script: 0x57, flags: 0x0}, + 1226: {region: 0x106, script: 0x57, flags: 0x0}, + 1227: {region: 0x6a, script: 0x57, flags: 0x0}, + 1228: {region: 0x12f, script: 0x57, flags: 0x0}, + 1229: {region: 0x165, script: 0x57, flags: 0x0}, + 1230: {region: 0x36, script: 0x57, flags: 0x0}, + 1231: {region: 0x4e, script: 0x57, flags: 0x0}, + 1232: {region: 0x165, script: 0x57, flags: 0x0}, + 1233: {region: 0x6f, script: 0x29, flags: 0x0}, + 1234: {region: 0x165, script: 0x57, flags: 0x0}, + 1235: {region: 0xe7, script: 0x57, flags: 0x0}, + 1236: {region: 0x2f, script: 0x57, flags: 0x0}, + 1237: {region: 0x99, script: 0xda, flags: 0x0}, + 1238: {region: 0x99, script: 0x21, flags: 0x0}, + 1239: {region: 0x165, script: 0x57, flags: 0x0}, + 1240: {region: 0x165, script: 0x57, flags: 0x0}, + 1241: {region: 0x165, script: 0x57, flags: 0x0}, + 1242: {region: 0x165, script: 0x57, flags: 0x0}, + 1243: {region: 0x165, script: 0x57, flags: 0x0}, + 1244: {region: 0x165, script: 0x57, flags: 0x0}, + 1245: {region: 0x165, script: 0x57, flags: 0x0}, + 1246: {region: 0x165, script: 0x57, flags: 0x0}, + 1247: {region: 0x165, script: 0x57, flags: 0x0}, + 1248: {region: 0x140, script: 0x57, flags: 0x0}, + 1249: {region: 0x165, script: 0x57, flags: 0x0}, + 1250: {region: 0x165, script: 0x57, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x57, flags: 0x0}, + 1253: {region: 0x114, script: 0x57, flags: 0x0}, + 1254: {region: 0x165, script: 0x57, flags: 0x0}, + 1255: {region: 0x165, script: 0x57, flags: 0x0}, + 1256: {region: 0x165, script: 0x57, flags: 0x0}, + 1257: {region: 0x165, script: 0x57, flags: 0x0}, + 1258: {region: 0x99, script: 0x21, flags: 0x0}, + 1259: {region: 0x53, script: 0x38, flags: 0x0}, + 1260: {region: 0x165, script: 0x57, flags: 0x0}, + 1261: {region: 0x165, script: 0x57, flags: 0x0}, + 1262: {region: 0x41, script: 0x57, flags: 0x0}, + 1263: {region: 0x165, script: 0x57, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x57, flags: 0x0}, + 1266: {region: 0x161, script: 0x57, flags: 0x0}, + 1267: {region: 0x165, script: 0x57, flags: 0x0}, + 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, + 1269: {region: 0x12b, script: 0x60, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, + 1271: {region: 0x53, script: 0x64, flags: 0x0}, + 1272: {region: 0x10b, script: 0x69, flags: 0x0}, + 1273: {region: 0x108, script: 0x73, flags: 0x0}, + 1274: {region: 0x99, script: 0x21, flags: 0x0}, + 1275: {region: 0x131, script: 0x57, flags: 0x0}, + 1276: {region: 0x165, script: 0x57, flags: 0x0}, + 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, + 1278: {region: 0x165, script: 0x57, flags: 0x0}, + 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, + 1280: {region: 0x165, script: 0x57, flags: 0x0}, + 1281: {region: 0x165, script: 0x57, flags: 0x0}, + 1282: {region: 0xdb, script: 0x21, flags: 0x0}, + 1283: {region: 0x165, script: 0x57, flags: 0x0}, + 1284: {region: 0x165, script: 0x57, flags: 0x0}, + 1285: {region: 0xd1, script: 0x57, flags: 0x0}, + 1286: {region: 0x75, script: 0x57, flags: 0x0}, + 1287: {region: 0x165, script: 0x57, flags: 0x0}, + 1288: {region: 0x165, script: 0x57, flags: 0x0}, + 1289: {region: 0x52, script: 0x57, flags: 0x0}, + 1290: {region: 0x165, script: 0x57, flags: 0x0}, + 1291: {region: 0x165, script: 0x57, flags: 0x0}, + 1292: {region: 0x165, script: 0x57, flags: 0x0}, + 1293: {region: 0x52, script: 0x57, flags: 0x0}, + 1294: {region: 0x165, script: 0x57, flags: 0x0}, + 1295: {region: 0x165, script: 0x57, flags: 0x0}, + 1296: {region: 0x165, script: 0x57, flags: 0x0}, + 1297: {region: 0x165, script: 0x57, flags: 0x0}, + 1298: {region: 0x1, script: 0x3b, flags: 0x0}, + 1299: {region: 0x165, script: 0x57, flags: 0x0}, + 1300: {region: 0x165, script: 0x57, flags: 0x0}, + 1301: {region: 0x165, script: 0x57, flags: 0x0}, + 1302: {region: 0x165, script: 0x57, flags: 0x0}, + 1303: {region: 0x165, script: 0x57, flags: 0x0}, + 1304: {region: 0xd6, script: 0x57, flags: 0x0}, + 1305: {region: 0x165, script: 0x57, flags: 0x0}, + 1306: {region: 0x165, script: 0x57, flags: 0x0}, + 1307: {region: 0x165, script: 0x57, flags: 0x0}, + 1308: {region: 0x41, script: 0x57, flags: 0x0}, + 1309: {region: 0x165, script: 0x57, flags: 0x0}, + 1310: {region: 0xcf, script: 0x57, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x57, flags: 0x0}, + 1313: {region: 0x165, script: 0x57, flags: 0x0}, + 1314: {region: 0x165, script: 0x57, flags: 0x0}, + 1315: {region: 0x53, script: 0x57, flags: 0x0}, + 1316: {region: 0x10b, script: 0x57, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x57, flags: 0x0}, + 1320: {region: 0xba, script: 0xdc, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x79, flags: 0x0}, + 1323: {region: 0x165, script: 0x57, flags: 0x0}, + 1324: {region: 0x122, script: 0x57, flags: 0x0}, + 1325: {region: 0xd0, script: 0x57, flags: 0x0}, + 1326: {region: 0x165, script: 0x57, flags: 0x0}, + 1327: {region: 0x161, script: 0x57, flags: 0x0}, + 1329: {region: 0x12b, script: 0x57, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x74, flags: 0x2}, + 2: {region: 0x11c, script: 0x80, flags: 0x2}, + 3: {region: 0x32, script: 0x57, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x1f, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x1f, flags: 0x0}, + 9: {region: 0x38, script: 0x2c, flags: 0x2}, + 10: {region: 0x135, script: 0x57, flags: 0x0}, + 11: {region: 0x7b, script: 0xc5, flags: 0x2}, + 12: {region: 0x114, script: 0x57, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1e, flags: 0x0}, + 15: {region: 0x87, script: 0x5c, flags: 0x2}, + 16: {region: 0xd6, script: 0x57, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x1f, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x57, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x1f, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x57, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x57, flags: 0x2}, + 33: {region: 0xdb, script: 0x21, flags: 0x0}, + 34: {region: 0x99, script: 0x5a, flags: 0x2}, + 35: {region: 0x83, script: 0x57, flags: 0x0}, + 36: {region: 0x84, script: 0x78, flags: 0x4}, + 37: {region: 0x84, script: 0x78, flags: 0x2}, + 38: {region: 0xc5, script: 0x1f, flags: 0x0}, + 39: {region: 0x53, script: 0x6d, flags: 0x4}, + 40: {region: 0x53, script: 0x6d, flags: 0x2}, + 41: {region: 0xd0, script: 0x57, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x33, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x84, flags: 0x0}, + 48: {region: 0x53, script: 0x85, flags: 0x2}, + 49: {region: 0xba, script: 0xdc, flags: 0x0}, + 50: {region: 0xd9, script: 0x57, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x21, flags: 0x2}, + 53: {region: 0x99, script: 0x4c, flags: 0x2}, + 54: {region: 0x99, script: 0xc9, flags: 0x2}, + 55: {region: 0x105, script: 0x1f, flags: 0x0}, + 56: {region: 0xbd, script: 0x57, flags: 0x4}, + 57: {region: 0x104, script: 0x57, flags: 0x4}, + 58: {region: 0x106, script: 0x57, flags: 0x4}, + 59: {region: 0x12b, script: 0x57, flags: 0x4}, + 60: {region: 0x124, script: 0x1f, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x1f, flags: 0x4}, + 65: {region: 0xc5, script: 0x1f, flags: 0x4}, + 66: {region: 0xae, script: 0x1f, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x21, flags: 0x4}, + 69: {region: 0xdb, script: 0x21, flags: 0x2}, + 70: {region: 0x137, script: 0x57, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x1f, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x39, flags: 0x0}, + 75: {region: 0x53, script: 0x38, flags: 0x4}, + 76: {region: 0x53, script: 0x38, flags: 0x2}, + 77: {region: 0x53, script: 0x38, flags: 0x0}, + 78: {region: 0x2f, script: 0x39, flags: 0x4}, + 79: {region: 0x3e, script: 0x39, flags: 0x4}, + 80: {region: 0x7b, script: 0x39, flags: 0x4}, + 81: {region: 0x7e, script: 0x39, flags: 0x4}, + 82: {region: 0x8d, script: 0x39, flags: 0x4}, + 83: {region: 0x95, script: 0x39, flags: 0x4}, + 84: {region: 0xc6, script: 0x39, flags: 0x4}, + 85: {region: 0xd0, script: 0x39, flags: 0x4}, + 86: {region: 0xe2, script: 0x39, flags: 0x4}, + 87: {region: 0xe5, script: 0x39, flags: 0x4}, + 88: {region: 0xe7, script: 0x39, flags: 0x4}, + 89: {region: 0x116, script: 0x39, flags: 0x4}, + 90: {region: 0x123, script: 0x39, flags: 0x4}, + 91: {region: 0x12e, script: 0x39, flags: 0x4}, + 92: {region: 0x135, script: 0x39, flags: 0x4}, + 93: {region: 0x13e, script: 0x39, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x34, flags: 0x2}, + 96: {region: 0x12e, script: 0x39, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 1432 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x57, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 43: {lang: 0x0, script: 0x57, flags: 0x0}, + 44: {lang: 0x13e, script: 0x57, flags: 0x0}, + 45: {lang: 0x41b, script: 0x57, flags: 0x0}, + 46: {lang: 0x10d, script: 0x57, flags: 0x0}, + 48: {lang: 0x367, script: 0x57, flags: 0x0}, + 49: {lang: 0x444, script: 0x57, flags: 0x0}, + 50: {lang: 0x58, script: 0x57, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x57, flags: 0x0}, + 55: {lang: 0x15e, script: 0x57, flags: 0x0}, + 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, + 59: {lang: 0x15e, script: 0x57, flags: 0x0}, + 60: {lang: 0x15e, script: 0x57, flags: 0x0}, + 62: {lang: 0x31f, script: 0x57, flags: 0x0}, + 63: {lang: 0x13e, script: 0x57, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x57, flags: 0x0}, + 71: {lang: 0x71, script: 0x1f, flags: 0x0}, + 73: {lang: 0x512, script: 0x3b, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x57, flags: 0x0}, + 76: {lang: 0x15e, script: 0x57, flags: 0x0}, + 77: {lang: 0x15e, script: 0x57, flags: 0x0}, + 78: {lang: 0x10d, script: 0x57, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 81: {lang: 0x13e, script: 0x57, flags: 0x0}, + 82: {lang: 0x15e, script: 0x57, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x57, flags: 0x0}, + 85: {lang: 0x0, script: 0x57, flags: 0x0}, + 86: {lang: 0x13e, script: 0x57, flags: 0x0}, + 89: {lang: 0x13e, script: 0x57, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x57, flags: 0x0}, + 96: {lang: 0x10d, script: 0x57, flags: 0x0}, + 98: {lang: 0x1, script: 0x57, flags: 0x0}, + 99: {lang: 0x101, script: 0x57, flags: 0x0}, + 101: {lang: 0x13e, script: 0x57, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x57, flags: 0x0}, + 105: {lang: 0x13e, script: 0x57, flags: 0x0}, + 106: {lang: 0x140, script: 0x57, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x29, flags: 0x0}, + 110: {lang: 0x13e, script: 0x57, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x57, flags: 0x0}, + 114: {lang: 0x151, script: 0x57, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, + 118: {lang: 0x158, script: 0x57, flags: 0x0}, + 120: {lang: 0x15e, script: 0x57, flags: 0x0}, + 122: {lang: 0x15e, script: 0x57, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x57, flags: 0x0}, + 128: {lang: 0x21, script: 0x57, flags: 0x0}, + 130: {lang: 0x245, script: 0x57, flags: 0x0}, + 132: {lang: 0x15e, script: 0x57, flags: 0x0}, + 133: {lang: 0x15e, script: 0x57, flags: 0x0}, + 134: {lang: 0x13e, script: 0x57, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x57, flags: 0x0}, + 137: {lang: 0x13e, script: 0x57, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 141: {lang: 0x529, script: 0x39, flags: 0x0}, + 142: {lang: 0x0, script: 0x57, flags: 0x0}, + 143: {lang: 0x13e, script: 0x57, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, + 148: {lang: 0x13e, script: 0x57, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x46, flags: 0x0}, + 164: {lang: 0x445, script: 0x57, flags: 0x0}, + 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x50, flags: 0x0}, + 171: {lang: 0x254, script: 0x50, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x57, flags: 0x0}, + 179: {lang: 0x40c, script: 0xca, flags: 0x0}, + 181: {lang: 0x43b, script: 0x57, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, + 183: {lang: 0x15e, script: 0x57, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x57, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x57, flags: 0x0}, + 190: {lang: 0x15e, script: 0x57, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x57, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x57, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x57, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xde, flags: 0x0}, + 207: {lang: 0x13e, script: 0x57, flags: 0x0}, + 208: {lang: 0x31f, script: 0x57, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 210: {lang: 0x16, script: 0x57, flags: 0x0}, + 211: {lang: 0x15e, script: 0x57, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x57, flags: 0x0}, + 217: {lang: 0x367, script: 0x57, flags: 0x0}, + 218: {lang: 0x347, script: 0x57, flags: 0x0}, + 219: {lang: 0x351, script: 0x21, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x57, flags: 0x0}, + 228: {lang: 0x13e, script: 0x57, flags: 0x0}, + 229: {lang: 0x15e, script: 0x57, flags: 0x0}, + 230: {lang: 0x486, script: 0x57, flags: 0x0}, + 231: {lang: 0x153, script: 0x57, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 234: {lang: 0x15e, script: 0x57, flags: 0x0}, + 236: {lang: 0x13e, script: 0x57, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, + 241: {lang: 0x194, script: 0x57, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x57, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x1f, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x57, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x57, flags: 0x0}, + 272: {lang: 0x347, script: 0x57, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 276: {lang: 0x15e, script: 0x57, flags: 0x0}, + 277: {lang: 0x429, script: 0x57, flags: 0x0}, + 278: {lang: 0x367, script: 0x57, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 282: {lang: 0x13e, script: 0x57, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x57, flags: 0x0}, + 289: {lang: 0x15e, script: 0x57, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x57, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 295: {lang: 0x476, script: 0x57, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x57, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x57, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x57, flags: 0x0}, + 309: {lang: 0x512, script: 0x3b, flags: 0x2}, + 310: {lang: 0x13e, script: 0x57, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 315: {lang: 0x13e, script: 0x57, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, + 319: {lang: 0x8a, script: 0x57, flags: 0x0}, + 320: {lang: 0x15e, script: 0x57, flags: 0x0}, + 322: {lang: 0x41b, script: 0x57, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x57, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 372 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x57, flags: 0x0}, + 2: {lang: 0x431, script: 0x57, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x57, flags: 0x0}, + 6: {lang: 0xb7, script: 0x57, flags: 0x0}, + 7: {lang: 0x432, script: 0x1f, flags: 0x0}, + 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, + 9: {lang: 0x351, script: 0x21, flags: 0x0}, + 10: {lang: 0x529, script: 0x38, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x57, flags: 0x0}, + 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, + 14: {lang: 0x136, script: 0x31, flags: 0x0}, + 15: {lang: 0x48a, script: 0x57, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x57, flags: 0x0}, + 18: {lang: 0x27, script: 0x29, flags: 0x0}, + 19: {lang: 0x139, script: 0x57, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3b, flags: 0x2}, + 22: {lang: 0x210, script: 0x2b, flags: 0x0}, + 23: {lang: 0x5, script: 0x1f, flags: 0x0}, + 24: {lang: 0x274, script: 0x57, flags: 0x0}, + 25: {lang: 0x136, script: 0x31, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x21, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x72, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x57, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xdf, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x57, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, + 40: {lang: 0x226, script: 0xdf, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x57, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 46: {lang: 0x431, script: 0x57, flags: 0x0}, + 47: {lang: 0x331, script: 0x72, flags: 0x0}, + 48: {lang: 0x213, script: 0x57, flags: 0x0}, + 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x39, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x57, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x21, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x21, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 64: {lang: 0x267, script: 0x57, flags: 0x0}, + 65: {lang: 0x444, script: 0x57, flags: 0x0}, + 66: {lang: 0x512, script: 0x3b, flags: 0x0}, + 67: {lang: 0x412, script: 0x57, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x57, flags: 0x0}, + 71: {lang: 0x15e, script: 0x57, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x72, flags: 0x0}, + 76: {lang: 0x467, script: 0x1f, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 80: {lang: 0x48a, script: 0x57, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x1f, flags: 0x0}, + 83: {lang: 0x81, script: 0x31, flags: 0x0}, + 84: {lang: 0x529, script: 0x39, flags: 0x0}, + 85: {lang: 0x48c, script: 0x57, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 87: {lang: 0x512, script: 0x3b, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 89: {lang: 0x431, script: 0x57, flags: 0x0}, + 90: {lang: 0x432, script: 0x1f, flags: 0x0}, + 91: {lang: 0x15e, script: 0x57, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint8 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x57}, + 2: {lang: 0x139, region: 0x135, script: 0x57}, + 3: {lang: 0x3c0, region: 0x41, script: 0x57}, + 4: {lang: 0x139, region: 0x2f, script: 0x57}, + 5: {lang: 0x139, region: 0xd6, script: 0x57}, + 6: {lang: 0x13e, region: 0xcf, script: 0x57}, + 7: {lang: 0x445, region: 0x12f, script: 0x57}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x57}, + 10: {lang: 0x139, region: 0x161, script: 0x57}, + 11: {lang: 0x139, region: 0x135, script: 0x57}, + 12: {lang: 0x139, region: 0x135, script: 0x57}, + 13: {lang: 0x13e, region: 0x59, script: 0x57}, + 14: {lang: 0x529, region: 0x53, script: 0x38}, + 15: {lang: 0x1be, region: 0x99, script: 0x21}, + 16: {lang: 0x1e1, region: 0x95, script: 0x57}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, + 18: {lang: 0x139, region: 0x2f, script: 0x57}, + 19: {lang: 0x139, region: 0xe6, script: 0x57}, + 20: {lang: 0x139, region: 0x8a, script: 0x57}, + 21: {lang: 0x41b, region: 0x142, script: 0x57}, + 22: {lang: 0x529, region: 0x53, script: 0x38}, + 23: {lang: 0x4bc, region: 0x137, script: 0x57}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 27: {lang: 0x139, region: 0x7b, script: 0x57}, + 28: {lang: 0x10d, region: 0x60, script: 0x57}, + 29: {lang: 0x139, region: 0xd6, script: 0x57}, + 30: {lang: 0x13e, region: 0x1f, script: 0x57}, + 31: {lang: 0x139, region: 0x9a, script: 0x57}, + 32: {lang: 0x139, region: 0x7b, script: 0x57}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 25886 bytes (25KiB); checksum: 50D3D57D diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000000..e7afd3188e --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/language/BUILD b/vendor/golang.org/x/text/language/BUILD index 3fadfd5d68..8159965f70 100644 --- a/vendor/golang.org/x/text/language/BUILD +++ b/vendor/golang.org/x/text/language/BUILD @@ -3,13 +3,11 @@ load("@io_bazel_rules_go//go:def.bzl", "go_library") go_library( name = "go_default_library", srcs = [ - "common.go", "coverage.go", + "doc.go", "go1_1.go", "go1_2.go", - "index.go", "language.go", - "lookup.go", "match.go", "parse.go", "tables.go", @@ -18,7 +16,10 @@ go_library( importmap = "k8s.io/kubernetes/vendor/golang.org/x/text/language", importpath = "golang.org/x/text/language", visibility = ["//visibility:public"], - deps = ["//vendor/golang.org/x/text/internal/tag:go_default_library"], + deps = [ + "//vendor/golang.org/x/text/internal/language:go_default_library", + "//vendor/golang.org/x/text/internal/language/compact:go_default_library", + ], ) filegroup( diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile deleted file mode 100644 index 79f005784f..0000000000 --- a/vendor/golang.org/x/text/language/Makefile +++ /dev/null @@ -1,16 +0,0 @@ -# Copyright 2013 The Go Authors. All rights reserved. -# Use of this source code is governed by a BSD-style -# license that can be found in the LICENSE file. - -CLEANFILES+=maketables - -maketables: maketables.go - go build $^ - -tables: maketables - ./maketables > tables.go - gofmt -w -s tables.go - -# Build (but do not run) maketables during testing, -# just to make sure it still compiles. -testshort: maketables diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go index 101fd23c1d..a24fd1a4d6 100644 --- a/vendor/golang.org/x/text/language/coverage.go +++ b/vendor/golang.org/x/text/language/coverage.go @@ -7,6 +7,8 @@ package language import ( "fmt" "sort" + + "golang.org/x/text/internal/language" ) // The Coverage interface is used to define the level of coverage of an @@ -44,9 +46,9 @@ type allSubtags struct{} // consecutive range, it simply returns a slice of numbers in increasing order. // The "undefined" region is not returned. func (s allSubtags) Regions() []Region { - reg := make([]Region, numRegions) + reg := make([]Region, language.NumRegions) for i := range reg { - reg[i] = Region{regionID(i + 1)} + reg[i] = Region{language.Region(i + 1)} } return reg } @@ -55,9 +57,9 @@ func (s allSubtags) Regions() []Region { // consecutive range, it simply returns a slice of numbers in increasing order. // The "undefined" script is not returned. func (s allSubtags) Scripts() []Script { - scr := make([]Script, numScripts) + scr := make([]Script, language.NumScripts) for i := range scr { - scr[i] = Script{scriptID(i + 1)} + scr[i] = Script{language.Script(i + 1)} } return scr } @@ -65,22 +67,10 @@ func (s allSubtags) Scripts() []Script { // BaseLanguages returns the list of all supported base languages. It generates // the list by traversing the internal structures. func (s allSubtags) BaseLanguages() []Base { - base := make([]Base, 0, numLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Base{langID(i)}) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Base{langID(i)}) - } - v >>= 1 - i++ - } + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} } return base } @@ -90,7 +80,7 @@ func (s allSubtags) Tags() []Tag { return nil } -// coverage is used used by NewCoverage which is used as a convenient way for +// coverage is used by NewCoverage which is used as a convenient way for // creating Coverage implementations for partially defined data. Very often a // package will only need to define a subset of slices. coverage provides a // convenient way to do this. Moreover, packages using NewCoverage, instead of @@ -134,7 +124,7 @@ func (s *coverage) BaseLanguages() []Base { } a := make([]Base, len(tags)) for i, t := range tags { - a[i] = Base{langID(t.lang)} + a[i] = Base{language.Language(t.lang())} } sort.Sort(bases(a)) k := 0 diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 0000000000..8afecd50e1 --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,102 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// +// Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// +// Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// +// Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +// +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go index 153269bc10..3004eb42c1 100644 --- a/vendor/golang.org/x/text/language/gen.go +++ b/vendor/golang.org/x/text/language/gen.go @@ -10,21 +10,16 @@ package main import ( - "bufio" "flag" "fmt" "io" - "io/ioutil" "log" - "math" - "reflect" - "regexp" "sort" "strconv" "strings" "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/tag" + "golang.org/x/text/internal/language" "golang.org/x/text/unicode/cldr" ) @@ -37,272 +32,17 @@ var ( "output file for generated tables") ) -var comment = []string{ - ` -lang holds an alphabetically sorted list of ISO-639 language identifiers. -All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -For 2-byte language identifiers, the two successive bytes have the following meaning: - - if the first letter of the 2- and 3-letter ISO codes are the same: - the second and third letter of the 3-letter ISO code. - - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -For 3-byte language identifiers the 4th byte is 0.`, - ` -langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -in lookup tables. The language ids for these language codes are derived directly -from the letters and are not consecutive.`, - ` -altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -to 2-letter language codes that cannot be derived using the method described above. -Each 3-letter code is followed by its 1-byte langID.`, - ` -altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, - ` -langAliasMap maps langIDs to their suggested replacements.`, - ` -script is an alphabetically sorted list of ISO 15924 codes. The index -of the script in the string, divided by 4, is the internal scriptID.`, - ` -isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -the UN.M49 codes used for groups.)`, - ` -regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -Each 2-letter codes is followed by two bytes with the following meaning: - - [A-Z}{2}: the first letter of the 2-letter code plus these two - letters form the 3-letter ISO code. - - 0, n: index into altRegionISO3.`, - ` -regionTypes defines the status of a region for various standards.`, - ` -m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -codes indicating collections of regions.`, - ` -m49Index gives indexes into fromM49 based on the three most significant bits -of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in - fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -The region code is stored in the 9 lsb of the indexed value.`, - ` -fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, - ` -altRegionISO3 holds a list of 3-letter region codes that cannot be -mapped to 2-letter codes using the default algorithm. This is a short list.`, - ` -altRegionIDs holds a list of regionIDs the positions of which match those -of the 3-letter ISO codes in altRegionISO3.`, - ` -variantNumSpecialized is the number of specialized variants in variants.`, - ` -suppressScript is an index from langID to the dominant script for that language, -if it exists. If a script is given, it should be suppressed from the language tag.`, - ` -likelyLang is a lookup table, indexed by langID, for the most likely -scripts and regions given incomplete information. If more entries exist for a -given language, region and script are the index and size respectively -of the list in likelyLangList.`, - ` -likelyLangList holds lists info associated with likelyLang.`, - ` -likelyRegion is a lookup table, indexed by regionID, for the most likely -languages and scripts given incomplete information. If more entries exist -for a given regionID, lang and script are the index and size respectively -of the list in likelyRegionList. -TODO: exclude containers and user-definable regions from the list.`, - ` -likelyRegionList holds lists info associated with likelyRegion.`, - ` -likelyScript is a lookup table, indexed by scriptID, for the most likely -languages and regions given a script.`, - ` -matchLang holds pairs of langIDs of base languages that are typically -mutually intelligible. Each pair is associated with a confidence and -whether the intelligibility goes one or both ways.`, - ` -matchScript holds pairs of scriptIDs where readers of one script -can typically also read the other. Each is associated with a confidence.`, - ` -nRegionGroups is the number of region groups.`, - ` -regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -where each set holds all groupings that are directly connected in a region -containment graph.`, - ` -regionInclusionBits is an array of bit vectors where every vector represents -a set of region groupings. These sets are used to compute the distance -between two regions for the purpose of language matching.`, - ` -regionInclusionNext marks, for each entry in regionInclusionBits, the set of -all groups that are reachable from the groups set in the respective entry.`, -} +func main() { + gen.Init() -// TODO: consider changing some of these structures to tries. This can reduce -// memory, but may increase the need for memory allocations. This could be -// mitigated if we can piggyback on language tags for common cases. + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "language") -func failOnError(e error) { - if e != nil { - log.Panic(e) - } -} + b := newBuilder(w) + gen.WriteCLDRVersion(w) -type setType int - -const ( - Indexed setType = 1 + iota // all elements must be of same size - Linear -) - -type stringSet struct { - s []string - sorted, frozen bool - - // We often need to update values after the creation of an index is completed. - // We include a convenience map for keeping track of this. - update map[string]string - typ setType // used for checking. -} - -func (ss *stringSet) clone() stringSet { - c := *ss - c.s = append([]string(nil), c.s...) - return c -} - -func (ss *stringSet) setType(t setType) { - if ss.typ != t && ss.typ != 0 { - log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) - } -} - -// parse parses a whitespace-separated string and initializes ss with its -// components. -func (ss *stringSet) parse(s string) { - scan := bufio.NewScanner(strings.NewReader(s)) - scan.Split(bufio.ScanWords) - for scan.Scan() { - ss.add(scan.Text()) - } -} - -func (ss *stringSet) assertChangeable() { - if ss.frozen { - log.Panic("attempt to modify a frozen stringSet") - } -} - -func (ss *stringSet) add(s string) { - ss.assertChangeable() - ss.s = append(ss.s, s) - ss.sorted = ss.frozen -} - -func (ss *stringSet) freeze() { - ss.compact() - ss.frozen = true -} - -func (ss *stringSet) compact() { - if ss.sorted { - return - } - a := ss.s - sort.Strings(a) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - a[k+1] = a[i] - k++ - } - } - ss.s = a[:k+1] - ss.sorted = ss.frozen -} - -type funcSorter struct { - fn func(a, b string) bool - sort.StringSlice -} - -func (s funcSorter) Less(i, j int) bool { - return s.fn(s.StringSlice[i], s.StringSlice[j]) -} - -func (ss *stringSet) sortFunc(f func(a, b string) bool) { - ss.compact() - sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) -} - -func (ss *stringSet) remove(s string) { - ss.assertChangeable() - if i, ok := ss.find(s); ok { - copy(ss.s[i:], ss.s[i+1:]) - ss.s = ss.s[:len(ss.s)-1] - } -} - -func (ss *stringSet) replace(ol, nu string) { - ss.s[ss.index(ol)] = nu - ss.sorted = ss.frozen -} - -func (ss *stringSet) index(s string) int { - ss.setType(Indexed) - i, ok := ss.find(s) - if !ok { - if i < len(ss.s) { - log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) - } - log.Panicf("find: item %q is not in list", s) - - } - return i -} - -func (ss *stringSet) find(s string) (int, bool) { - ss.compact() - i := sort.SearchStrings(ss.s, s) - return i, i != len(ss.s) && ss.s[i] == s -} - -func (ss *stringSet) slice() []string { - ss.compact() - return ss.s -} - -func (ss *stringSet) updateLater(v, key string) { - if ss.update == nil { - ss.update = map[string]string{} - } - ss.update[v] = key -} - -// join joins the string and ensures that all entries are of the same length. -func (ss *stringSet) join() string { - ss.setType(Indexed) - n := len(ss.s[0]) - for _, s := range ss.s { - if len(s) != n { - log.Panicf("join: not all entries are of the same length: %q", s) - } - } - ss.s = append(ss.s, strings.Repeat("\xff", n)) - return strings.Join(ss.s, "") -} - -// ianaEntry holds information for an entry in the IANA Language Subtag Repository. -// All types use the same entry. -// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various -// fields. -type ianaEntry struct { - typ string - description []string - scope string - added string - preferred string - deprecated string - suppressScript string - macro string - prefix []string + b.writeConstants() + b.writeMatchData() } type builder struct { @@ -310,546 +50,51 @@ type builder struct { hw io.Writer // MultiWriter for w and w.Hash data *cldr.CLDR supp *cldr.SupplementalData - - // indices - locale stringSet // common locales - lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data - langNoIndex stringSet // 3-letter ISO codes with no associated data - script stringSet // 4-letter ISO codes - region stringSet // 2-letter ISO or 3-digit UN M49 codes - variant stringSet // 4-8-alphanumeric variant code. - - // Region codes that are groups with their corresponding group IDs. - groups map[int]index - - // langInfo - registry map[string]*ianaEntry } -type index uint +func (b *builder) langIndex(s string) uint16 { + return uint16(language.MustParseBase(s)) +} + +func (b *builder) regionIndex(s string) int { + return int(language.MustParseRegion(s)) +} + +func (b *builder) scriptIndex(s string) int { + return int(language.MustParseScript(s)) +} func newBuilder(w *gen.CodeWriter) *builder { r := gen.OpenCLDRCoreZip() defer r.Close() d := &cldr.Decoder{} data, err := d.DecodeZip(r) - failOnError(err) + if err != nil { + log.Fatal(err) + } b := builder{ w: w, hw: io.MultiWriter(w, w.Hash), data: data, supp: data.Supplemental(), } - b.parseRegistry() return &b } -func (b *builder) parseRegistry() { - r := gen.OpenIANAFile("assignments/language-subtag-registry") - defer r.Close() - b.registry = make(map[string]*ianaEntry) - - scan := bufio.NewScanner(r) - scan.Split(bufio.ScanWords) - var record *ianaEntry - for more := scan.Scan(); more; { - key := scan.Text() - more = scan.Scan() - value := scan.Text() - switch key { - case "Type:": - record = &ianaEntry{typ: value} - case "Subtag:", "Tag:": - if s := strings.SplitN(value, "..", 2); len(s) > 1 { - for a := s[0]; a <= s[1]; a = inc(a) { - b.addToRegistry(a, record) - } - } else { - b.addToRegistry(value, record) - } - case "Suppress-Script:": - record.suppressScript = value - case "Added:": - record.added = value - case "Deprecated:": - record.deprecated = value - case "Macrolanguage:": - record.macro = value - case "Preferred-Value:": - record.preferred = value - case "Prefix:": - record.prefix = append(record.prefix, value) - case "Scope:": - record.scope = value - case "Description:": - buf := []byte(value) - for more = scan.Scan(); more; more = scan.Scan() { - b := scan.Bytes() - if b[0] == '%' || b[len(b)-1] == ':' { - break - } - buf = append(buf, ' ') - buf = append(buf, b...) - } - record.description = append(record.description, string(buf)) - continue - default: - continue - } - more = scan.Scan() - } - if scan.Err() != nil { - log.Panic(scan.Err()) - } -} - -func (b *builder) addToRegistry(key string, entry *ianaEntry) { - if info, ok := b.registry[key]; ok { - if info.typ != "language" || entry.typ != "extlang" { - log.Fatalf("parseRegistry: tag %q already exists", key) - } - } else { - b.registry[key] = entry - } -} - -var commentIndex = make(map[string]string) - -func init() { - for _, s := range comment { - key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) - commentIndex[key] = s - } -} - -func (b *builder) comment(name string) { - if s := commentIndex[name]; len(s) > 0 { - b.w.WriteComment(s) - } else { - fmt.Fprintln(b.w) - } -} - -func (b *builder) pf(f string, x ...interface{}) { - fmt.Fprintf(b.hw, f, x...) - fmt.Fprint(b.hw, "\n") -} - -func (b *builder) p(x ...interface{}) { - fmt.Fprintln(b.hw, x...) -} - -func (b *builder) addSize(s int) { - b.w.Size += s - b.pf("// Size: %d bytes", s) -} - -func (b *builder) writeConst(name string, x interface{}) { - b.comment(name) - b.w.WriteConst(name, x) -} - // writeConsts computes f(v) for all v in values and writes the results // as constants named _v to a single constant block. func (b *builder) writeConsts(f func(string) int, values ...string) { - b.pf("const (") + fmt.Fprintln(b.w, "const (") for _, v := range values { - b.pf("\t_%s = %v", v, f(v)) + fmt.Fprintf(b.w, "\t_%s = %v\n", v, f(v)) } - b.pf(")") -} - -// writeType writes the type of the given value, which must be a struct. -func (b *builder) writeType(value interface{}) { - b.comment(reflect.TypeOf(value).Name()) - b.w.WriteType(value) -} - -func (b *builder) writeSlice(name string, ss interface{}) { - b.writeSliceAddSize(name, 0, ss) -} - -func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { - b.comment(name) - b.w.Size += extraSize - v := reflect.ValueOf(ss) - t := v.Type().Elem() - b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) - - fmt.Fprintf(b.w, "var %s = ", name) - b.w.WriteArray(ss) - b.p() -} - -type fromTo struct { - from, to uint16 -} - -func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { - ss.sortFunc(func(a, b string) bool { - return index(a) < index(b) - }) - m := []fromTo{} - for _, s := range ss.s { - m = append(m, fromTo{index(s), index(ss.update[s])}) - } - b.writeSlice(name, m) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s string) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -func (b *builder) writeBitVector(name string, ss []string) { - vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) - for _, s := range ss { - v := strToInt(s) - vec[v/8] |= 1 << (v % 8) - } - b.writeSlice(name, vec) -} - -// TODO: convert this type into a list or two-stage trie. -func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size())) - for _, k := range m { - sz += len(k) - } - b.addSize(sz) - keys := []string{} - b.pf(`var %s = map[string]uint16{`, name) - for k := range m { - keys = append(keys, k) - } - sort.Strings(keys) - for _, k := range keys { - b.pf("\t%q: %v,", k, f(m[k])) - } - b.p("}") -} - -func (b *builder) writeMap(name string, m interface{}) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) - b.addSize(sz) - f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { - return strings.IndexRune("{}, ", r) != -1 - }) - sort.Strings(f[1:]) - b.pf(`var %s = %s{`, name, f[0]) - for _, kv := range f[1:] { - b.pf("\t%s,", kv) - } - b.p("}") -} - -func (b *builder) langIndex(s string) uint16 { - if s == "und" { - return 0 - } - if i, ok := b.lang.find(s); ok { - return uint16(i) - } - return uint16(strToInt(s)) + uint16(len(b.lang.s)) -} - -// inc advances the string to its lexicographical successor. -func inc(s string) string { - const maxTagLength = 4 - var buf [maxTagLength]byte - intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) - for i := 0; i < len(s); i++ { - if s[i] <= 'Z' { - buf[i] -= 'a' - 'A' - } - } - return string(buf[:len(s)]) -} - -func (b *builder) parseIndices() { - meta := b.supp.Metadata - - for k, v := range b.registry { - var ss *stringSet - switch v.typ { - case "language": - if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { - b.lang.add(k) - continue - } else { - ss = &b.langNoIndex - } - case "region": - ss = &b.region - case "script": - ss = &b.script - case "variant": - ss = &b.variant - default: - continue - } - ss.add(k) - } - // Include any language for which there is data. - for _, lang := range b.data.Locales() { - if x := b.data.RawLDML(lang); false || - x.LocaleDisplayNames != nil || - x.Characters != nil || - x.Delimiters != nil || - x.Measurement != nil || - x.Dates != nil || - x.Numbers != nil || - x.Units != nil || - x.ListPatterns != nil || - x.Collations != nil || - x.Segmentations != nil || - x.Rbnf != nil || - x.Annotations != nil || - x.Metadata != nil { - - from := strings.Split(lang, "_") - if lang := from[0]; lang != "root" { - b.lang.add(lang) - } - } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range b.data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - if lang = strings.Split(lang, "_")[0]; lang != "root" { - b.lang.add(lang) - } - } - } - } - // Include languages in likely subtags. - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - b.lang.add(from[0]) - } - // Include ISO-639 alpha-3 bibliographic entries. - for _, a := range meta.Alias.LanguageAlias { - if a.Reason == "bibliographic" { - b.langNoIndex.add(a.Type) - } - } - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 { - b.region.add(reg.Type) - } - } - - for _, s := range b.lang.s { - if len(s) == 3 { - b.langNoIndex.remove(s) - } - } - b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) - b.writeConst("numScripts", len(b.script.slice())) - b.writeConst("numRegions", len(b.region.slice())) - - // Add dummy codes at the start of each list to represent "unspecified". - b.lang.add("---") - b.script.add("----") - b.region.add("---") - - // common locales - b.locale.parse(meta.DefaultContent.Locales) + fmt.Fprintln(b.w, ")") } // TODO: region inclusion data will probably not be use used in future matchers. -func (b *builder) computeRegionGroups() { - b.groups = make(map[int]index) - - // Create group indices. - for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. - b.groups[i] = index(len(b.groups)) - } - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - if _, ok := b.groups[group]; !ok { - b.groups[group] = index(len(b.groups)) - } - } - if len(b.groups) > 32 { - log.Fatalf("only 32 groups supported, found %d", len(b.groups)) - } - b.writeConst("nRegionGroups", len(b.groups)) -} - var langConsts = []string{ - "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", - "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", - "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", - "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", - "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", - "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", - - // constants for grandfathered tags (if not already defined) - "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", - "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", -} - -// writeLanguage generates all tables needed for language canonicalization. -func (b *builder) writeLanguage() { - meta := b.supp.Metadata - - b.writeConst("nonCanonicalUnd", b.lang.index("und")) - b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) - b.writeConst("langPrivateStart", b.langIndex("qaa")) - b.writeConst("langPrivateEnd", b.langIndex("qtz")) - - // Get language codes that need to be mapped (overlong 3-letter codes, - // deprecated 2-letter codes, legacy and grandfathered tags.) - langAliasMap := stringSet{} - aliasTypeMap := map[string]langAliasType{} - - // altLangISO3 get the alternative ISO3 names that need to be mapped. - altLangISO3 := stringSet{} - // Add dummy start to avoid the use of index 0. - altLangISO3.add("---") - altLangISO3.updateLater("---", "aa") - - lang := b.lang.clone() - for _, a := range meta.Alias.LanguageAlias { - if a.Replacement == "" { - a.Replacement = "und" - } - // TODO: support mapping to tags - repl := strings.SplitN(a.Replacement, "_", 2)[0] - if a.Reason == "overlong" { - if len(a.Replacement) == 2 && len(a.Type) == 3 { - lang.updateLater(a.Replacement, a.Type) - } - } else if len(a.Type) <= 3 { - switch a.Reason { - case "macrolanguage": - aliasTypeMap[a.Type] = langMacro - case "deprecated": - // handled elsewhere - continue - case "bibliographic", "legacy": - if a.Type == "no" { - continue - } - aliasTypeMap[a.Type] = langLegacy - default: - log.Fatalf("new %s alias: %s", a.Reason, a.Type) - } - langAliasMap.add(a.Type) - langAliasMap.updateLater(a.Type, repl) - } - } - // Manually add the mapping of "nb" (Norwegian) to its macro language. - // This can be removed if CLDR adopts this change. - langAliasMap.add("nb") - langAliasMap.updateLater("nb", "no") - aliasTypeMap["nb"] = langMacro - - for k, v := range b.registry { - // Also add deprecated values for 3-letter ISO codes, which CLDR omits. - if v.typ == "language" && v.deprecated != "" && v.preferred != "" { - langAliasMap.add(k) - langAliasMap.updateLater(k, v.preferred) - aliasTypeMap[k] = langDeprecated - } - } - // Fix CLDR mappings. - lang.updateLater("tl", "tgl") - lang.updateLater("sh", "hbs") - lang.updateLater("mo", "mol") - lang.updateLater("no", "nor") - lang.updateLater("tw", "twi") - lang.updateLater("nb", "nob") - lang.updateLater("ak", "aka") - lang.updateLater("bh", "bih") - - // Ensure that each 2-letter code is matched with a 3-letter code. - for _, v := range lang.s[1:] { - s, ok := lang.update[v] - if !ok { - if s, ok = lang.update[langAliasMap.update[v]]; !ok { - continue - } - lang.update[v] = s - } - if v[0] != s[0] { - altLangISO3.add(s) - altLangISO3.updateLater(s, v) - } - } - - // Complete canonicalized language tags. - lang.freeze() - for i, v := range lang.s { - // We can avoid these manual entries by using the IANA registry directly. - // Seems easier to update the list manually, as changes are rare. - // The panic in this loop will trigger if we miss an entry. - add := "" - if s, ok := lang.update[v]; ok { - if s[0] == v[0] { - add = s[1:] - } else { - add = string([]byte{0, byte(altLangISO3.index(s))}) - } - } else if len(v) == 3 { - add = "\x00" - } else { - log.Panicf("no data for long form of %q", v) - } - lang.s[i] += add - } - b.writeConst("lang", tag.Index(lang.join())) - - b.writeConst("langNoIndexOffset", len(b.lang.s)) - - // space of all valid 3-letter language identifiers. - b.writeBitVector("langNoIndex", b.langNoIndex.slice()) - - altLangIndex := []uint16{} - for i, s := range altLangISO3.slice() { - altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) - if i > 0 { - idx := b.lang.index(altLangISO3.update[s]) - altLangIndex = append(altLangIndex, uint16(idx)) - } - } - b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) - b.writeSlice("altLangIndex", altLangIndex) - - b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex) - types := make([]langAliasType, len(langAliasMap.s)) - for i, s := range langAliasMap.s { - types[i] = aliasTypeMap[s] - } - b.writeSlice("langAliasTypes", types) + "de", "en", "fr", "it", "mo", "no", "nb", "pt", "sh", "mul", "und", } var scriptConsts = []string{ @@ -857,508 +102,15 @@ var scriptConsts = []string{ "Zzzz", } -func (b *builder) writeScript() { - b.writeConsts(b.script.index, scriptConsts...) - b.writeConst("script", tag.Index(b.script.join())) - - supp := make([]uint8, len(b.lang.slice())) - for i, v := range b.lang.slice()[1:] { - if sc := b.registry[v].suppressScript; sc != "" { - supp[i+1] = uint8(b.script.index(sc)) - } - } - b.writeSlice("suppressScript", supp) - - // There is only one deprecated script in CLDR. This value is hard-coded. - // We check here if the code must be updated. - for _, a := range b.supp.Metadata.Alias.ScriptAlias { - if a.Type != "Qaai" { - log.Panicf("unexpected deprecated stript %q", a.Type) - } - } -} - -func parseM49(s string) int16 { - if len(s) == 0 { - return 0 - } - v, err := strconv.ParseUint(s, 10, 10) - failOnError(err) - return int16(v) -} - var regionConsts = []string{ "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. } -func (b *builder) writeRegion() { - b.writeConsts(b.region.index, regionConsts...) - - isoOffset := b.region.index("AA") - m49map := make([]int16, len(b.region.slice())) - fromM49map := make(map[int16]int) - altRegionISO3 := "" - altRegionIDs := []uint16{} - - b.writeConst("isoRegionOffset", isoOffset) - - // 2-letter region lookup and mapping to numeric codes. - regionISO := b.region.clone() - regionISO.s = regionISO.s[isoOffset:] - regionISO.sorted = false - - regionTypes := make([]byte, len(b.region.s)) - - // Is the region valid BCP 47? - for s, e := range b.registry { - if len(s) == 2 && s == strings.ToUpper(s) { - i := b.region.index(s) - for _, d := range e.description { - if strings.Contains(d, "Private use") { - regionTypes[i] = iso3166UserAssigned - } - } - regionTypes[i] |= bcp47Region - } - } - - // Is the region a valid ccTLD? - r := gen.OpenIANAFile("domains/root/db") - defer r.Close() - - buf, err := ioutil.ReadAll(r) - failOnError(err) - re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) - for _, m := range re.FindAllSubmatch(buf, -1) { - i := b.region.index(strings.ToUpper(string(m[1]))) - regionTypes[i] |= ccTLD - } - - b.writeSlice("regionTypes", regionTypes) - - iso3Set := make(map[string]int) - update := func(iso2, iso3 string) { - i := regionISO.index(iso2) - if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { - regionISO.s[i] += iso3[1:] - iso3Set[iso3] = -1 - } else { - if ok && j >= 0 { - regionISO.s[i] += string([]byte{0, byte(j)}) - } else { - iso3Set[iso3] = len(altRegionISO3) - regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) - altRegionISO3 += iso3 - altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - i := regionISO.index(tc.Type) + isoOffset - if d := m49map[i]; d != 0 { - log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) - } - m49 := parseM49(tc.Numeric) - m49map[i] = m49 - if r := fromM49map[m49]; r == 0 { - fromM49map[m49] = i - } else if r != i { - dep := b.registry[regionISO.s[r-isoOffset]].deprecated - if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { - fromM49map[m49] = i - } - } - } - for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { - if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { - from := parseM49(ta.Type) - if r := fromM49map[from]; r == 0 { - fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - if len(tc.Alpha3) == 3 { - update(tc.Type, tc.Alpha3) - } - } - // This entries are not included in territoryCodes. Mostly 3-letter variants - // of deleted codes and an entry for QU. - for _, m := range []struct{ iso2, iso3 string }{ - {"CT", "CTE"}, - {"DY", "DHY"}, - {"HV", "HVO"}, - {"JT", "JTN"}, - {"MI", "MID"}, - {"NH", "NHB"}, - {"NQ", "ATN"}, - {"PC", "PCI"}, - {"PU", "PUS"}, - {"PZ", "PCZ"}, - {"RH", "RHO"}, - {"VD", "VDR"}, - {"WK", "WAK"}, - // These three-letter codes are used for others as well. - {"FQ", "ATF"}, - } { - update(m.iso2, m.iso3) - } - for i, s := range regionISO.s { - if len(s) != 4 { - regionISO.s[i] = s + " " - } - } - b.writeConst("regionISO", tag.Index(regionISO.join())) - b.writeConst("altRegionISO3", altRegionISO3) - b.writeSlice("altRegionIDs", altRegionIDs) - - // Create list of deprecated regions. - // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only - // Transitionally-reserved mapping not included. - regionOldMap := stringSet{} - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { - regionOldMap.add(reg.Type) - regionOldMap.updateLater(reg.Type, reg.Replacement) - i, _ := regionISO.find(reg.Type) - j, _ := regionISO.find(reg.Replacement) - if k := m49map[i+isoOffset]; k == 0 { - m49map[i+isoOffset] = m49map[j+isoOffset] - } - } - } - b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { - return uint16(b.region.index(s)) - }) - // 3-digit region lookup, groupings. - for i := 1; i < isoOffset; i++ { - m := parseM49(b.region.s[i]) - m49map[i] = m - fromM49map[m] = i - } - b.writeSlice("m49", m49map) - - const ( - searchBits = 7 - regionBits = 9 - ) - if len(m49map) >= 1< %d", len(m49map), 1<>searchBits] = int16(len(fromM49)) - } - b.writeSlice("m49Index", m49Index) - b.writeSlice("fromM49", fromM49) -} - -const ( - // TODO: put these lists in regionTypes as user data? Could be used for - // various optimizations and refinements and could be exposed in the API. - iso3166Except = "AC CP DG EA EU FX IC SU TA UK" - iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. - // DY and RH are actually not deleted, but indeterminately reserved. - iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" -) - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func find(list []string, s string) int { - for i, t := range list { - if t == s { - return i - } - } - return -1 -} - -// writeVariants generates per-variant information and creates a map from variant -// name to index value. We assign index values such that sorting multiple -// variants by index value will result in the correct order. -// There are two types of variants: specialized and general. Specialized variants -// are only applicable to certain language or language-script pairs. Generalized -// variants apply to any language. Generalized variants always sort after -// specialized variants. We will therefore always assign a higher index value -// to a generalized variant than any other variant. Generalized variants are -// sorted alphabetically among themselves. -// Specialized variants may also sort after other specialized variants. Such -// variants will be ordered after any of the variants they may follow. -// We assume that if a variant x is followed by a variant y, then for any prefix -// p of x, p-x is a prefix of y. This allows us to order tags based on the -// maximum of the length of any of its prefixes. -// TODO: it is possible to define a set of Prefix values on variants such that -// a total order cannot be defined to the point that this algorithm breaks. -// In other words, we cannot guarantee the same order of variants for the -// future using the same algorithm or for non-compliant combinations of -// variants. For this reason, consider using simple alphabetic sorting -// of variants and ignore Prefix restrictions altogether. -func (b *builder) writeVariant() { - generalized := stringSet{} - specialized := stringSet{} - specializedExtend := stringSet{} - // Collate the variants by type and check assumptions. - for _, v := range b.variant.slice() { - e := b.registry[v] - if len(e.prefix) == 0 { - generalized.add(v) - continue - } - c := strings.Split(e.prefix[0], "-") - hasScriptOrRegion := false - if len(c) > 1 { - _, hasScriptOrRegion = b.script.find(c[1]) - if !hasScriptOrRegion { - _, hasScriptOrRegion = b.region.find(c[1]) - - } - } - if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { - // Variant is preceded by a language. - specialized.add(v) - continue - } - // Variant is preceded by another variant. - specializedExtend.add(v) - prefix := c[0] + "-" - if hasScriptOrRegion { - prefix += c[1] - } - for _, p := range e.prefix { - // Verify that the prefix minus the last element is a prefix of the - // predecessor element. - i := strings.LastIndex(p, "-") - pred := b.registry[p[i+1:]] - if find(pred.prefix, p[:i]) < 0 { - log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) - } - // The sorting used below does not work in the general case. It works - // if we assume that variants that may be followed by others only have - // prefixes of the same length. Verify this. - count := strings.Count(p[:i], "-") - for _, q := range pred.prefix { - if c := strings.Count(q, "-"); c != count { - log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) - } - } - if !strings.HasPrefix(p, prefix) { - log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) - } - } - } - - // Sort extended variants. - a := specializedExtend.s - less := func(v, w string) bool { - // Sort by the maximum number of elements. - maxCount := func(s string) (max int) { - for _, p := range b.registry[s].prefix { - if c := strings.Count(p, "-"); c > max { - max = c - } - } - return - } - if cv, cw := maxCount(v), maxCount(w); cv != cw { - return cv < cw - } - // Sort by name as tie breaker. - return v < w - } - sort.Sort(funcSorter{less, sort.StringSlice(a)}) - specializedExtend.frozen = true - - // Create index from variant name to index. - variantIndex := make(map[string]uint8) - add := func(s []string) { - for _, v := range s { - variantIndex[v] = uint8(len(variantIndex)) - } - } - add(specialized.slice()) - add(specializedExtend.s) - numSpecialized := len(variantIndex) - add(generalized.slice()) - if n := len(variantIndex); n > 255 { - log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) - } - b.writeMap("variantIndex", variantIndex) - b.writeConst("variantNumSpecialized", numSpecialized) -} - -func (b *builder) writeLanguageInfo() { -} - -// writeLikelyData writes tables that are used both for finding parent relations and for -// language matching. Each entry contains additional bits to indicate the status of the -// data to know when it cannot be used for parent relations. -func (b *builder) writeLikelyData() { - const ( - isList = 1 << iota - scriptInFrom - regionInFrom - ) - type ( // generated types - likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 - } - likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 - } - likelyLangRegion struct { - lang uint16 - region uint16 - } - // likelyTag is used for getting likely tags for group regions, where - // the likely region might be a region contained in the group. - likelyTag struct { - lang uint16 - region uint16 - script uint8 - } - ) - var ( // generated variables - likelyRegionGroup = make([]likelyTag, len(b.groups)) - likelyLang = make([]likelyScriptRegion, len(b.lang.s)) - likelyRegion = make([]likelyLangScript, len(b.region.s)) - likelyScript = make([]likelyLangRegion, len(b.script.s)) - likelyLangList = []likelyScriptRegion{} - likelyRegionList = []likelyLangScript{} - ) - type fromTo struct { - from, to []string - } - langToOther := map[int][]fromTo{} - regionToOther := map[int][]fromTo{} - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - to := strings.Split(m.To, "_") - if len(to) != 3 { - log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) - } - if len(from) > 3 { - log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) - } - if from[0] != to[0] && from[0] != "und" { - log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) - } - if len(from) == 3 { - if from[2] != to[2] { - log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) - } - if from[0] != "und" { - log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) - } - } - if len(from) == 1 || from[0] != "und" { - id := 0 - if from[0] != "und" { - id = b.lang.index(from[0]) - } - langToOther[id] = append(langToOther[id], fromTo{from, to}) - } else if len(from) == 2 && len(from[1]) == 4 { - sid := b.script.index(from[1]) - likelyScript[sid].lang = uint16(b.langIndex(to[0])) - likelyScript[sid].region = uint16(b.region.index(to[2])) - } else { - r := b.region.index(from[len(from)-1]) - if id, ok := b.groups[r]; ok { - if from[0] != "und" { - log.Fatalf("region changed unexpectedly: %s -> %s", from, to) - } - likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) - likelyRegionGroup[id].script = uint8(b.script.index(to[1])) - likelyRegionGroup[id].region = uint16(b.region.index(to[2])) - } else { - regionToOther[r] = append(regionToOther[r], fromTo{from, to}) - } - } - } - b.writeType(likelyLangRegion{}) - b.writeSlice("likelyScript", likelyScript) - - for id := range b.lang.s { - list := langToOther[id] - if len(list) == 1 { - likelyLang[id].region = uint16(b.region.index(list[0].to[2])) - likelyLang[id].script = uint8(b.script.index(list[0].to[1])) - } else if len(list) > 1 { - likelyLang[id].flags = isList - likelyLang[id].region = uint16(len(likelyLangList)) - likelyLang[id].script = uint8(len(list)) - for _, x := range list { - flags := uint8(0) - if len(x.from) > 1 { - if x.from[1] == x.to[2] { - flags = regionInFrom - } else { - flags = scriptInFrom - } - } - likelyLangList = append(likelyLangList, likelyScriptRegion{ - region: uint16(b.region.index(x.to[2])), - script: uint8(b.script.index(x.to[1])), - flags: flags, - }) - } - } - } - // TODO: merge suppressScript data with this table. - b.writeType(likelyScriptRegion{}) - b.writeSlice("likelyLang", likelyLang) - b.writeSlice("likelyLangList", likelyLangList) - - for id := range b.region.s { - list := regionToOther[id] - if len(list) == 1 { - likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) - likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) - if len(list[0].from) > 2 { - likelyRegion[id].flags = scriptInFrom - } - } else if len(list) > 1 { - likelyRegion[id].flags = isList - likelyRegion[id].lang = uint16(len(likelyRegionList)) - likelyRegion[id].script = uint8(len(list)) - for i, x := range list { - if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { - log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) - } - x := likelyLangScript{ - lang: uint16(b.langIndex(x.to[0])), - script: uint8(b.script.index(x.to[1])), - } - if len(list[0].from) > 2 { - x.flags = scriptInFrom - } - likelyRegionList = append(likelyRegionList, x) - } - } - } - b.writeType(likelyLangScript{}) - b.writeSlice("likelyRegion", likelyRegion) - b.writeSlice("likelyRegionList", likelyRegionList) - - b.writeType(likelyTag{}) - b.writeSlice("likelyRegionGroup", likelyRegionGroup) +func (b *builder) writeConstants() { + b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) + b.writeConsts(b.regionIndex, regionConsts...) + b.writeConsts(b.scriptIndex, scriptConsts...) } type mutualIntelligibility struct { @@ -1397,7 +149,7 @@ func (b *builder) writeMatchData() { regions := strings.Split(g.Contains, " ") regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...) } - regionToGroups := make([]uint8, len(b.region.s)) + regionToGroups := make([]uint8, language.NumRegions) idToIndex := map[string]uint8{} for i, mv := range lm[0].MatchVariable { @@ -1410,27 +162,34 @@ func (b *builder) writeMatchData() { todo := []string{r} for k := 0; k < len(todo); k++ { r := todo[k] - regionToGroups[b.region.index(r)] |= 1 << uint8(i) + regionToGroups[b.regionIndex(r)] |= 1 << uint8(i) todo = append(todo, regionHierarchy[r]...) } } } - b.writeSlice("regionToGroups", regionToGroups) + b.w.WriteVar("regionToGroups", regionToGroups) - b.writeType(mutualIntelligibility{}) - b.writeType(scriptIntelligibility{}) - b.writeType(regionIntelligibility{}) + // maps language id to in- and out-of-group region. + paradigmLocales := [][3]uint16{} + locales := strings.Split(lm[0].ParadigmLocales[0].Locales, " ") + for i := 0; i < len(locales); i += 2 { + x := [3]uint16{} + for j := 0; j < 2; j++ { + pc := strings.SplitN(locales[i+j], "-", 2) + x[0] = b.langIndex(pc[0]) + if len(pc) == 2 { + x[1+j] = uint16(b.regionIndex(pc[1])) + } + } + paradigmLocales = append(paradigmLocales, x) + } + b.w.WriteVar("paradigmLocales", paradigmLocales) - matchLang := []mutualIntelligibility{{ - // TODO: remove once CLDR is fixed. - want: uint16(b.langIndex("sr")), - have: uint16(b.langIndex("hr")), - distance: uint8(5), - }, { - want: uint16(b.langIndex("sr")), - have: uint16(b.langIndex("bs")), - distance: uint8(5), - }} + b.w.WriteType(mutualIntelligibility{}) + b.w.WriteType(scriptIntelligibility{}) + b.w.WriteType(regionIntelligibility{}) + + matchLang := []mutualIntelligibility{} matchScript := []scriptIntelligibility{} matchRegion := []regionIntelligibility{} // Convert the languageMatch entries in lists keyed by desired language. @@ -1454,16 +213,16 @@ func (b *builder) writeMatchData() { matchScript = append(matchScript, scriptIntelligibility{ wantLang: uint16(b.langIndex(d[0])), haveLang: uint16(b.langIndex(s[0])), - wantScript: uint8(b.script.index(d[1])), - haveScript: uint8(b.script.index(s[1])), + wantScript: uint8(b.scriptIndex(d[1])), + haveScript: uint8(b.scriptIndex(s[1])), distance: uint8(distance), }) if m.Oneway != "true" { matchScript = append(matchScript, scriptIntelligibility{ wantLang: uint16(b.langIndex(s[0])), haveLang: uint16(b.langIndex(d[0])), - wantScript: uint8(b.script.index(s[1])), - haveScript: uint8(b.script.index(d[1])), + wantScript: uint8(b.scriptIndex(s[1])), + haveScript: uint8(b.scriptIndex(d[1])), distance: uint8(distance), }) } @@ -1490,8 +249,14 @@ func (b *builder) writeMatchData() { if desired == supported && desired == "*_*_*" { continue } - if desired != supported { // (Weird but correct.) - log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) + if desired != supported { + // This is now supported by CLDR, but only one case, which + // should already be covered by paradigm locales. For instance, + // test case "und, en, en-GU, en-IN, en-GB ; en-ZA ; en-GB" in + // testdata/CLDRLocaleMatcherTest.txt tests this. + if supported != "en_*_GB" { + log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) + } continue } ri := regionIntelligibility{ @@ -1499,7 +264,7 @@ func (b *builder) writeMatchData() { distance: uint8(distance), } if d[1] != "*" { - ri.script = uint8(b.script.index(d[1])) + ri.script = uint8(b.scriptIndex(d[1])) } switch { case d[2] == "*": @@ -1519,181 +284,22 @@ func (b *builder) writeMatchData() { sort.SliceStable(matchLang, func(i, j int) bool { return matchLang[i].distance < matchLang[j].distance }) - b.writeSlice("matchLang", matchLang) + b.w.WriteComment(` + matchLang holds pairs of langIDs of base languages that are typically + mutually intelligible. Each pair is associated with a confidence and + whether the intelligibility goes one or both ways.`) + b.w.WriteVar("matchLang", matchLang) + b.w.WriteComment(` + matchScript holds pairs of scriptIDs where readers of one script + can typically also read the other. Each is associated with a confidence.`) sort.SliceStable(matchScript, func(i, j int) bool { return matchScript[i].distance < matchScript[j].distance }) - b.writeSlice("matchScript", matchScript) + b.w.WriteVar("matchScript", matchScript) sort.SliceStable(matchRegion, func(i, j int) bool { return matchRegion[i].distance < matchRegion[j].distance }) - b.writeSlice("matchRegion", matchRegion) -} - -func (b *builder) writeRegionInclusionData() { - var ( - // mm holds for each group the set of groups with a distance of 1. - mm = make(map[int][]index) - - // containment holds for each group the transitive closure of - // containment of other groups. - containment = make(map[index][]index) - ) - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - groupIdx := b.groups[group] - for _, mem := range strings.Split(g.Contains, " ") { - r := b.region.index(mem) - mm[r] = append(mm[r], groupIdx) - if g, ok := b.groups[r]; ok { - mm[group] = append(mm[group], g) - containment[groupIdx] = append(containment[groupIdx], g) - } - } - } - - regionContainment := make([]uint32, len(b.groups)) - for _, g := range b.groups { - l := containment[g] - - // Compute the transitive closure of containment. - for i := 0; i < len(l); i++ { - l = append(l, containment[l[i]]...) - } - - // Compute the bitmask. - regionContainment[g] = 1 << g - for _, v := range l { - regionContainment[g] |= 1 << v - } - } - b.writeSlice("regionContainment", regionContainment) - - regionInclusion := make([]uint8, len(b.region.s)) - bvs := make(map[uint32]index) - // Make the first bitvector positions correspond with the groups. - for r, i := range b.groups { - bv := uint32(1 << i) - for _, g := range mm[r] { - bv |= 1 << g - } - bvs[bv] = i - regionInclusion[r] = uint8(bvs[bv]) - } - for r := 1; r < len(b.region.s); r++ { - if _, ok := b.groups[r]; !ok { - bv := uint32(0) - for _, g := range mm[r] { - bv |= 1 << g - } - if bv == 0 { - // Pick the world for unspecified regions. - bv = 1 << b.groups[b.region.index("001")] - } - if _, ok := bvs[bv]; !ok { - bvs[bv] = index(len(bvs)) - } - regionInclusion[r] = uint8(bvs[bv]) - } - } - b.writeSlice("regionInclusion", regionInclusion) - regionInclusionBits := make([]uint32, len(bvs)) - for k, v := range bvs { - regionInclusionBits[v] = uint32(k) - } - // Add bit vectors for increasingly large distances until a fixed point is reached. - regionInclusionNext := []uint8{} - for i := 0; i < len(regionInclusionBits); i++ { - bits := regionInclusionBits[i] - next := bits - for i := uint(0); i < uint(len(b.groups)); i++ { - if bits&(1< b'. Using - // bytes.Replace will do. - out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1) - if err := ioutil.WriteFile("index.go", out, 0600); err != nil { - log.Fatalf("Could not create file index.go: %v", err) - } - }() - - m := map[language.Tag]bool{} - for _, lang := range data.Locales() { - // We include all locales unconditionally to be consistent with en_US. - // We want en_US, even though it has no data associated with it. - - // TODO: put any of the languages for which no data exists at the end - // of the index. This allows all components based on ICU to use that - // as the cutoff point. - // if x := data.RawLDML(lang); false || - // x.LocaleDisplayNames != nil || - // x.Characters != nil || - // x.Delimiters != nil || - // x.Measurement != nil || - // x.Dates != nil || - // x.Numbers != nil || - // x.Units != nil || - // x.ListPatterns != nil || - // x.Collations != nil || - // x.Segmentations != nil || - // x.Rbnf != nil || - // x.Annotations != nil || - // x.Metadata != nil { - - // TODO: support POSIX natively, albeit non-standard. - tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) - m[tag] = true - // } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - m[language.Make(lang)] = true - } - } - } - - var core, special []language.Tag - - for t := range m { - if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { - log.Fatalf("Unexpected extension %v in %v", x, t) - } - if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { - core = append(core, t) - } else { - special = append(special, t) - } - } - - w.WriteComment(` - NumCompactTags is the number of common tags. The maximum tag is - NumCompactTags-1.`) - w.WriteConst("NumCompactTags", len(core)+len(special)) - - sort.Sort(byAlpha(special)) - w.WriteVar("specialTags", special) - - // TODO: order by frequency? - sort.Sort(byAlpha(core)) - - // Size computations are just an estimate. - w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size()) - w.Size += len(core) * 6 // size of uint32 and uint16 - - fmt.Fprintln(w) - fmt.Fprintln(w, "var coreTags = map[uint32]uint16{") - fmt.Fprintln(w, "0x0: 0, // und") - i := len(special) + 1 // Und and special tags already written. - for _, t := range core { - if t == language.Und { - continue - } - fmt.Fprint(w.Hash, t, i) - b, s, r := t.Raw() - fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n", - getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number - getIndex(s, 2), - getIndex(r, 3), - i, t) - i++ - } - fmt.Fprintln(w, "}") -} - -// getIndex prints the subtag type and extracts its index of size nibble. -// If the index is less than n nibbles, the result is prefixed with 0s. -func getIndex(x interface{}, n int) string { - s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00} - s = s[strings.Index(s, "0x")+2 : len(s)-1] - return strings.Repeat("0", n-len(s)) + s -} - -type byAlpha []language.Tag - -func (a byAlpha) Len() int { return len(a) } -func (a byAlpha) Swap(i, j int) { a[i], a[j] = a[j], a[i] } -func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() } diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go deleted file mode 100644 index 973db9fd54..0000000000 --- a/vendor/golang.org/x/text/language/index.go +++ /dev/null @@ -1,769 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 754 - -var specialTags = []Tag{ // 2 elements - 0: {lang: 0xd7, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, - 1: {lang: 0x138, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, -} // Size: 72 bytes - -var coreTags = map[uint32]uint16{ - 0x0: 0, // und - 0x01600000: 3, // af - 0x016000d1: 4, // af-NA - 0x01600160: 5, // af-ZA - 0x01c00000: 6, // agq - 0x01c00051: 7, // agq-CM - 0x02100000: 8, // ak - 0x0210007f: 9, // ak-GH - 0x02700000: 10, // am - 0x0270006e: 11, // am-ET - 0x03a00000: 12, // ar - 0x03a00001: 13, // ar-001 - 0x03a00022: 14, // ar-AE - 0x03a00038: 15, // ar-BH - 0x03a00061: 16, // ar-DJ - 0x03a00066: 17, // ar-DZ - 0x03a0006a: 18, // ar-EG - 0x03a0006b: 19, // ar-EH - 0x03a0006c: 20, // ar-ER - 0x03a00096: 21, // ar-IL - 0x03a0009a: 22, // ar-IQ - 0x03a000a0: 23, // ar-JO - 0x03a000a7: 24, // ar-KM - 0x03a000ab: 25, // ar-KW - 0x03a000af: 26, // ar-LB - 0x03a000b8: 27, // ar-LY - 0x03a000b9: 28, // ar-MA - 0x03a000c8: 29, // ar-MR - 0x03a000e0: 30, // ar-OM - 0x03a000ec: 31, // ar-PS - 0x03a000f2: 32, // ar-QA - 0x03a00107: 33, // ar-SA - 0x03a0010a: 34, // ar-SD - 0x03a00114: 35, // ar-SO - 0x03a00116: 36, // ar-SS - 0x03a0011b: 37, // ar-SY - 0x03a0011f: 38, // ar-TD - 0x03a00127: 39, // ar-TN - 0x03a0015d: 40, // ar-YE - 0x04000000: 41, // ars - 0x04300000: 42, // as - 0x04300098: 43, // as-IN - 0x04400000: 44, // asa - 0x0440012e: 45, // asa-TZ - 0x04800000: 46, // ast - 0x0480006d: 47, // ast-ES - 0x05800000: 48, // az - 0x0581e000: 49, // az-Cyrl - 0x0581e031: 50, // az-Cyrl-AZ - 0x05852000: 51, // az-Latn - 0x05852031: 52, // az-Latn-AZ - 0x05e00000: 53, // bas - 0x05e00051: 54, // bas-CM - 0x07100000: 55, // be - 0x07100046: 56, // be-BY - 0x07500000: 57, // bem - 0x07500161: 58, // bem-ZM - 0x07900000: 59, // bez - 0x0790012e: 60, // bez-TZ - 0x07e00000: 61, // bg - 0x07e00037: 62, // bg-BG - 0x08200000: 63, // bh - 0x0a000000: 64, // bm - 0x0a0000c2: 65, // bm-ML - 0x0a500000: 66, // bn - 0x0a500034: 67, // bn-BD - 0x0a500098: 68, // bn-IN - 0x0a900000: 69, // bo - 0x0a900052: 70, // bo-CN - 0x0a900098: 71, // bo-IN - 0x0b200000: 72, // br - 0x0b200077: 73, // br-FR - 0x0b500000: 74, // brx - 0x0b500098: 75, // brx-IN - 0x0b700000: 76, // bs - 0x0b71e000: 77, // bs-Cyrl - 0x0b71e032: 78, // bs-Cyrl-BA - 0x0b752000: 79, // bs-Latn - 0x0b752032: 80, // bs-Latn-BA - 0x0d700000: 81, // ca - 0x0d700021: 82, // ca-AD - 0x0d70006d: 83, // ca-ES - 0x0d700077: 84, // ca-FR - 0x0d70009d: 85, // ca-IT - 0x0dc00000: 86, // ce - 0x0dc00105: 87, // ce-RU - 0x0df00000: 88, // cgg - 0x0df00130: 89, // cgg-UG - 0x0e500000: 90, // chr - 0x0e500134: 91, // chr-US - 0x0e900000: 92, // ckb - 0x0e90009a: 93, // ckb-IQ - 0x0e90009b: 94, // ckb-IR - 0x0f900000: 95, // cs - 0x0f90005d: 96, // cs-CZ - 0x0fd00000: 97, // cu - 0x0fd00105: 98, // cu-RU - 0x0ff00000: 99, // cy - 0x0ff0007a: 100, // cy-GB - 0x10000000: 101, // da - 0x10000062: 102, // da-DK - 0x10000081: 103, // da-GL - 0x10700000: 104, // dav - 0x107000a3: 105, // dav-KE - 0x10c00000: 106, // de - 0x10c0002d: 107, // de-AT - 0x10c00035: 108, // de-BE - 0x10c0004d: 109, // de-CH - 0x10c0005f: 110, // de-DE - 0x10c0009d: 111, // de-IT - 0x10c000b1: 112, // de-LI - 0x10c000b6: 113, // de-LU - 0x11600000: 114, // dje - 0x116000d3: 115, // dje-NE - 0x11e00000: 116, // dsb - 0x11e0005f: 117, // dsb-DE - 0x12300000: 118, // dua - 0x12300051: 119, // dua-CM - 0x12700000: 120, // dv - 0x12a00000: 121, // dyo - 0x12a00113: 122, // dyo-SN - 0x12c00000: 123, // dz - 0x12c00042: 124, // dz-BT - 0x12e00000: 125, // ebu - 0x12e000a3: 126, // ebu-KE - 0x12f00000: 127, // ee - 0x12f0007f: 128, // ee-GH - 0x12f00121: 129, // ee-TG - 0x13500000: 130, // el - 0x1350005c: 131, // el-CY - 0x13500086: 132, // el-GR - 0x13800000: 133, // en - 0x13800001: 134, // en-001 - 0x1380001a: 135, // en-150 - 0x13800024: 136, // en-AG - 0x13800025: 137, // en-AI - 0x1380002c: 138, // en-AS - 0x1380002d: 139, // en-AT - 0x1380002e: 140, // en-AU - 0x13800033: 141, // en-BB - 0x13800035: 142, // en-BE - 0x13800039: 143, // en-BI - 0x1380003c: 144, // en-BM - 0x13800041: 145, // en-BS - 0x13800045: 146, // en-BW - 0x13800047: 147, // en-BZ - 0x13800048: 148, // en-CA - 0x13800049: 149, // en-CC - 0x1380004d: 150, // en-CH - 0x1380004f: 151, // en-CK - 0x13800051: 152, // en-CM - 0x1380005b: 153, // en-CX - 0x1380005c: 154, // en-CY - 0x1380005f: 155, // en-DE - 0x13800060: 156, // en-DG - 0x13800062: 157, // en-DK - 0x13800063: 158, // en-DM - 0x1380006c: 159, // en-ER - 0x13800071: 160, // en-FI - 0x13800072: 161, // en-FJ - 0x13800073: 162, // en-FK - 0x13800074: 163, // en-FM - 0x1380007a: 164, // en-GB - 0x1380007b: 165, // en-GD - 0x1380007e: 166, // en-GG - 0x1380007f: 167, // en-GH - 0x13800080: 168, // en-GI - 0x13800082: 169, // en-GM - 0x13800089: 170, // en-GU - 0x1380008b: 171, // en-GY - 0x1380008c: 172, // en-HK - 0x13800095: 173, // en-IE - 0x13800096: 174, // en-IL - 0x13800097: 175, // en-IM - 0x13800098: 176, // en-IN - 0x13800099: 177, // en-IO - 0x1380009e: 178, // en-JE - 0x1380009f: 179, // en-JM - 0x138000a3: 180, // en-KE - 0x138000a6: 181, // en-KI - 0x138000a8: 182, // en-KN - 0x138000ac: 183, // en-KY - 0x138000b0: 184, // en-LC - 0x138000b3: 185, // en-LR - 0x138000b4: 186, // en-LS - 0x138000be: 187, // en-MG - 0x138000bf: 188, // en-MH - 0x138000c5: 189, // en-MO - 0x138000c6: 190, // en-MP - 0x138000c9: 191, // en-MS - 0x138000ca: 192, // en-MT - 0x138000cb: 193, // en-MU - 0x138000cd: 194, // en-MW - 0x138000cf: 195, // en-MY - 0x138000d1: 196, // en-NA - 0x138000d4: 197, // en-NF - 0x138000d5: 198, // en-NG - 0x138000d8: 199, // en-NL - 0x138000dc: 200, // en-NR - 0x138000de: 201, // en-NU - 0x138000df: 202, // en-NZ - 0x138000e5: 203, // en-PG - 0x138000e6: 204, // en-PH - 0x138000e7: 205, // en-PK - 0x138000ea: 206, // en-PN - 0x138000eb: 207, // en-PR - 0x138000ef: 208, // en-PW - 0x13800106: 209, // en-RW - 0x13800108: 210, // en-SB - 0x13800109: 211, // en-SC - 0x1380010a: 212, // en-SD - 0x1380010b: 213, // en-SE - 0x1380010c: 214, // en-SG - 0x1380010d: 215, // en-SH - 0x1380010e: 216, // en-SI - 0x13800111: 217, // en-SL - 0x13800116: 218, // en-SS - 0x1380011a: 219, // en-SX - 0x1380011c: 220, // en-SZ - 0x1380011e: 221, // en-TC - 0x13800124: 222, // en-TK - 0x13800128: 223, // en-TO - 0x1380012b: 224, // en-TT - 0x1380012c: 225, // en-TV - 0x1380012e: 226, // en-TZ - 0x13800130: 227, // en-UG - 0x13800132: 228, // en-UM - 0x13800134: 229, // en-US - 0x13800138: 230, // en-VC - 0x1380013b: 231, // en-VG - 0x1380013c: 232, // en-VI - 0x1380013e: 233, // en-VU - 0x13800141: 234, // en-WS - 0x13800160: 235, // en-ZA - 0x13800161: 236, // en-ZM - 0x13800163: 237, // en-ZW - 0x13b00000: 238, // eo - 0x13b00001: 239, // eo-001 - 0x13d00000: 240, // es - 0x13d0001e: 241, // es-419 - 0x13d0002b: 242, // es-AR - 0x13d0003e: 243, // es-BO - 0x13d00040: 244, // es-BR - 0x13d00047: 245, // es-BZ - 0x13d00050: 246, // es-CL - 0x13d00053: 247, // es-CO - 0x13d00055: 248, // es-CR - 0x13d00058: 249, // es-CU - 0x13d00064: 250, // es-DO - 0x13d00067: 251, // es-EA - 0x13d00068: 252, // es-EC - 0x13d0006d: 253, // es-ES - 0x13d00085: 254, // es-GQ - 0x13d00088: 255, // es-GT - 0x13d0008e: 256, // es-HN - 0x13d00093: 257, // es-IC - 0x13d000ce: 258, // es-MX - 0x13d000d7: 259, // es-NI - 0x13d000e1: 260, // es-PA - 0x13d000e3: 261, // es-PE - 0x13d000e6: 262, // es-PH - 0x13d000eb: 263, // es-PR - 0x13d000f0: 264, // es-PY - 0x13d00119: 265, // es-SV - 0x13d00134: 266, // es-US - 0x13d00135: 267, // es-UY - 0x13d0013a: 268, // es-VE - 0x13f00000: 269, // et - 0x13f00069: 270, // et-EE - 0x14400000: 271, // eu - 0x1440006d: 272, // eu-ES - 0x14500000: 273, // ewo - 0x14500051: 274, // ewo-CM - 0x14700000: 275, // fa - 0x14700023: 276, // fa-AF - 0x1470009b: 277, // fa-IR - 0x14d00000: 278, // ff - 0x14d00051: 279, // ff-CM - 0x14d00083: 280, // ff-GN - 0x14d000c8: 281, // ff-MR - 0x14d00113: 282, // ff-SN - 0x15000000: 283, // fi - 0x15000071: 284, // fi-FI - 0x15200000: 285, // fil - 0x152000e6: 286, // fil-PH - 0x15700000: 287, // fo - 0x15700062: 288, // fo-DK - 0x15700075: 289, // fo-FO - 0x15d00000: 290, // fr - 0x15d00035: 291, // fr-BE - 0x15d00036: 292, // fr-BF - 0x15d00039: 293, // fr-BI - 0x15d0003a: 294, // fr-BJ - 0x15d0003b: 295, // fr-BL - 0x15d00048: 296, // fr-CA - 0x15d0004a: 297, // fr-CD - 0x15d0004b: 298, // fr-CF - 0x15d0004c: 299, // fr-CG - 0x15d0004d: 300, // fr-CH - 0x15d0004e: 301, // fr-CI - 0x15d00051: 302, // fr-CM - 0x15d00061: 303, // fr-DJ - 0x15d00066: 304, // fr-DZ - 0x15d00077: 305, // fr-FR - 0x15d00079: 306, // fr-GA - 0x15d0007d: 307, // fr-GF - 0x15d00083: 308, // fr-GN - 0x15d00084: 309, // fr-GP - 0x15d00085: 310, // fr-GQ - 0x15d00090: 311, // fr-HT - 0x15d000a7: 312, // fr-KM - 0x15d000b6: 313, // fr-LU - 0x15d000b9: 314, // fr-MA - 0x15d000ba: 315, // fr-MC - 0x15d000bd: 316, // fr-MF - 0x15d000be: 317, // fr-MG - 0x15d000c2: 318, // fr-ML - 0x15d000c7: 319, // fr-MQ - 0x15d000c8: 320, // fr-MR - 0x15d000cb: 321, // fr-MU - 0x15d000d2: 322, // fr-NC - 0x15d000d3: 323, // fr-NE - 0x15d000e4: 324, // fr-PF - 0x15d000e9: 325, // fr-PM - 0x15d00101: 326, // fr-RE - 0x15d00106: 327, // fr-RW - 0x15d00109: 328, // fr-SC - 0x15d00113: 329, // fr-SN - 0x15d0011b: 330, // fr-SY - 0x15d0011f: 331, // fr-TD - 0x15d00121: 332, // fr-TG - 0x15d00127: 333, // fr-TN - 0x15d0013e: 334, // fr-VU - 0x15d0013f: 335, // fr-WF - 0x15d0015e: 336, // fr-YT - 0x16800000: 337, // fur - 0x1680009d: 338, // fur-IT - 0x16c00000: 339, // fy - 0x16c000d8: 340, // fy-NL - 0x16d00000: 341, // ga - 0x16d00095: 342, // ga-IE - 0x17c00000: 343, // gd - 0x17c0007a: 344, // gd-GB - 0x18e00000: 345, // gl - 0x18e0006d: 346, // gl-ES - 0x1a100000: 347, // gsw - 0x1a10004d: 348, // gsw-CH - 0x1a100077: 349, // gsw-FR - 0x1a1000b1: 350, // gsw-LI - 0x1a200000: 351, // gu - 0x1a200098: 352, // gu-IN - 0x1a700000: 353, // guw - 0x1a900000: 354, // guz - 0x1a9000a3: 355, // guz-KE - 0x1aa00000: 356, // gv - 0x1aa00097: 357, // gv-IM - 0x1b200000: 358, // ha - 0x1b20007f: 359, // ha-GH - 0x1b2000d3: 360, // ha-NE - 0x1b2000d5: 361, // ha-NG - 0x1b600000: 362, // haw - 0x1b600134: 363, // haw-US - 0x1ba00000: 364, // he - 0x1ba00096: 365, // he-IL - 0x1bc00000: 366, // hi - 0x1bc00098: 367, // hi-IN - 0x1cf00000: 368, // hr - 0x1cf00032: 369, // hr-BA - 0x1cf0008f: 370, // hr-HR - 0x1d000000: 371, // hsb - 0x1d00005f: 372, // hsb-DE - 0x1d300000: 373, // hu - 0x1d300091: 374, // hu-HU - 0x1d500000: 375, // hy - 0x1d500027: 376, // hy-AM - 0x1df00000: 377, // id - 0x1df00094: 378, // id-ID - 0x1e500000: 379, // ig - 0x1e5000d5: 380, // ig-NG - 0x1e800000: 381, // ii - 0x1e800052: 382, // ii-CN - 0x1f600000: 383, // is - 0x1f60009c: 384, // is-IS - 0x1f700000: 385, // it - 0x1f70004d: 386, // it-CH - 0x1f70009d: 387, // it-IT - 0x1f700112: 388, // it-SM - 0x1f700137: 389, // it-VA - 0x1f800000: 390, // iu - 0x1fe00000: 391, // ja - 0x1fe000a1: 392, // ja-JP - 0x20100000: 393, // jbo - 0x20500000: 394, // jgo - 0x20500051: 395, // jgo-CM - 0x20800000: 396, // jmc - 0x2080012e: 397, // jmc-TZ - 0x20c00000: 398, // jv - 0x20e00000: 399, // ka - 0x20e0007c: 400, // ka-GE - 0x21000000: 401, // kab - 0x21000066: 402, // kab-DZ - 0x21400000: 403, // kaj - 0x21500000: 404, // kam - 0x215000a3: 405, // kam-KE - 0x21d00000: 406, // kcg - 0x22100000: 407, // kde - 0x2210012e: 408, // kde-TZ - 0x22500000: 409, // kea - 0x22500059: 410, // kea-CV - 0x23200000: 411, // khq - 0x232000c2: 412, // khq-ML - 0x23700000: 413, // ki - 0x237000a3: 414, // ki-KE - 0x24000000: 415, // kk - 0x240000ad: 416, // kk-KZ - 0x24200000: 417, // kkj - 0x24200051: 418, // kkj-CM - 0x24300000: 419, // kl - 0x24300081: 420, // kl-GL - 0x24400000: 421, // kln - 0x244000a3: 422, // kln-KE - 0x24800000: 423, // km - 0x248000a5: 424, // km-KH - 0x24f00000: 425, // kn - 0x24f00098: 426, // kn-IN - 0x25200000: 427, // ko - 0x252000a9: 428, // ko-KP - 0x252000aa: 429, // ko-KR - 0x25400000: 430, // kok - 0x25400098: 431, // kok-IN - 0x26800000: 432, // ks - 0x26800098: 433, // ks-IN - 0x26900000: 434, // ksb - 0x2690012e: 435, // ksb-TZ - 0x26b00000: 436, // ksf - 0x26b00051: 437, // ksf-CM - 0x26c00000: 438, // ksh - 0x26c0005f: 439, // ksh-DE - 0x27200000: 440, // ku - 0x27f00000: 441, // kw - 0x27f0007a: 442, // kw-GB - 0x28800000: 443, // ky - 0x288000a4: 444, // ky-KG - 0x28f00000: 445, // lag - 0x28f0012e: 446, // lag-TZ - 0x29300000: 447, // lb - 0x293000b6: 448, // lb-LU - 0x2a100000: 449, // lg - 0x2a100130: 450, // lg-UG - 0x2ad00000: 451, // lkt - 0x2ad00134: 452, // lkt-US - 0x2b300000: 453, // ln - 0x2b300029: 454, // ln-AO - 0x2b30004a: 455, // ln-CD - 0x2b30004b: 456, // ln-CF - 0x2b30004c: 457, // ln-CG - 0x2b600000: 458, // lo - 0x2b6000ae: 459, // lo-LA - 0x2bd00000: 460, // lrc - 0x2bd0009a: 461, // lrc-IQ - 0x2bd0009b: 462, // lrc-IR - 0x2be00000: 463, // lt - 0x2be000b5: 464, // lt-LT - 0x2c000000: 465, // lu - 0x2c00004a: 466, // lu-CD - 0x2c200000: 467, // luo - 0x2c2000a3: 468, // luo-KE - 0x2c300000: 469, // luy - 0x2c3000a3: 470, // luy-KE - 0x2c500000: 471, // lv - 0x2c5000b7: 472, // lv-LV - 0x2cf00000: 473, // mas - 0x2cf000a3: 474, // mas-KE - 0x2cf0012e: 475, // mas-TZ - 0x2e700000: 476, // mer - 0x2e7000a3: 477, // mer-KE - 0x2eb00000: 478, // mfe - 0x2eb000cb: 479, // mfe-MU - 0x2ef00000: 480, // mg - 0x2ef000be: 481, // mg-MG - 0x2f000000: 482, // mgh - 0x2f0000d0: 483, // mgh-MZ - 0x2f200000: 484, // mgo - 0x2f200051: 485, // mgo-CM - 0x2fd00000: 486, // mk - 0x2fd000c1: 487, // mk-MK - 0x30200000: 488, // ml - 0x30200098: 489, // ml-IN - 0x30900000: 490, // mn - 0x309000c4: 491, // mn-MN - 0x31900000: 492, // mr - 0x31900098: 493, // mr-IN - 0x31d00000: 494, // ms - 0x31d0003d: 495, // ms-BN - 0x31d000cf: 496, // ms-MY - 0x31d0010c: 497, // ms-SG - 0x31e00000: 498, // mt - 0x31e000ca: 499, // mt-MT - 0x32300000: 500, // mua - 0x32300051: 501, // mua-CM - 0x32f00000: 502, // my - 0x32f000c3: 503, // my-MM - 0x33800000: 504, // mzn - 0x3380009b: 505, // mzn-IR - 0x33f00000: 506, // nah - 0x34300000: 507, // naq - 0x343000d1: 508, // naq-NA - 0x34500000: 509, // nb - 0x345000d9: 510, // nb-NO - 0x3450010f: 511, // nb-SJ - 0x34c00000: 512, // nd - 0x34c00163: 513, // nd-ZW - 0x34e00000: 514, // nds - 0x34e0005f: 515, // nds-DE - 0x34e000d8: 516, // nds-NL - 0x34f00000: 517, // ne - 0x34f00098: 518, // ne-IN - 0x34f000da: 519, // ne-NP - 0x36500000: 520, // nl - 0x3650002f: 521, // nl-AW - 0x36500035: 522, // nl-BE - 0x3650003f: 523, // nl-BQ - 0x3650005a: 524, // nl-CW - 0x365000d8: 525, // nl-NL - 0x36500115: 526, // nl-SR - 0x3650011a: 527, // nl-SX - 0x36600000: 528, // nmg - 0x36600051: 529, // nmg-CM - 0x36800000: 530, // nn - 0x368000d9: 531, // nn-NO - 0x36a00000: 532, // nnh - 0x36a00051: 533, // nnh-CM - 0x36d00000: 534, // no - 0x37300000: 535, // nqo - 0x37400000: 536, // nr - 0x37800000: 537, // nso - 0x37e00000: 538, // nus - 0x37e00116: 539, // nus-SS - 0x38500000: 540, // ny - 0x38700000: 541, // nyn - 0x38700130: 542, // nyn-UG - 0x38e00000: 543, // om - 0x38e0006e: 544, // om-ET - 0x38e000a3: 545, // om-KE - 0x39300000: 546, // or - 0x39300098: 547, // or-IN - 0x39600000: 548, // os - 0x3960007c: 549, // os-GE - 0x39600105: 550, // os-RU - 0x39b00000: 551, // pa - 0x39b05000: 552, // pa-Arab - 0x39b050e7: 553, // pa-Arab-PK - 0x39b2f000: 554, // pa-Guru - 0x39b2f098: 555, // pa-Guru-IN - 0x39f00000: 556, // pap - 0x3b100000: 557, // pl - 0x3b1000e8: 558, // pl-PL - 0x3bb00000: 559, // prg - 0x3bb00001: 560, // prg-001 - 0x3bc00000: 561, // ps - 0x3bc00023: 562, // ps-AF - 0x3be00000: 563, // pt - 0x3be00029: 564, // pt-AO - 0x3be00040: 565, // pt-BR - 0x3be0004d: 566, // pt-CH - 0x3be00059: 567, // pt-CV - 0x3be00085: 568, // pt-GQ - 0x3be0008a: 569, // pt-GW - 0x3be000b6: 570, // pt-LU - 0x3be000c5: 571, // pt-MO - 0x3be000d0: 572, // pt-MZ - 0x3be000ed: 573, // pt-PT - 0x3be00117: 574, // pt-ST - 0x3be00125: 575, // pt-TL - 0x3c200000: 576, // qu - 0x3c20003e: 577, // qu-BO - 0x3c200068: 578, // qu-EC - 0x3c2000e3: 579, // qu-PE - 0x3d200000: 580, // rm - 0x3d20004d: 581, // rm-CH - 0x3d700000: 582, // rn - 0x3d700039: 583, // rn-BI - 0x3da00000: 584, // ro - 0x3da000bb: 585, // ro-MD - 0x3da00103: 586, // ro-RO - 0x3dc00000: 587, // rof - 0x3dc0012e: 588, // rof-TZ - 0x3e000000: 589, // ru - 0x3e000046: 590, // ru-BY - 0x3e0000a4: 591, // ru-KG - 0x3e0000ad: 592, // ru-KZ - 0x3e0000bb: 593, // ru-MD - 0x3e000105: 594, // ru-RU - 0x3e00012f: 595, // ru-UA - 0x3e300000: 596, // rw - 0x3e300106: 597, // rw-RW - 0x3e400000: 598, // rwk - 0x3e40012e: 599, // rwk-TZ - 0x3e900000: 600, // sah - 0x3e900105: 601, // sah-RU - 0x3ea00000: 602, // saq - 0x3ea000a3: 603, // saq-KE - 0x3f100000: 604, // sbp - 0x3f10012e: 605, // sbp-TZ - 0x3fa00000: 606, // sdh - 0x3fb00000: 607, // se - 0x3fb00071: 608, // se-FI - 0x3fb000d9: 609, // se-NO - 0x3fb0010b: 610, // se-SE - 0x3fd00000: 611, // seh - 0x3fd000d0: 612, // seh-MZ - 0x3ff00000: 613, // ses - 0x3ff000c2: 614, // ses-ML - 0x40000000: 615, // sg - 0x4000004b: 616, // sg-CF - 0x40600000: 617, // shi - 0x40652000: 618, // shi-Latn - 0x406520b9: 619, // shi-Latn-MA - 0x406d2000: 620, // shi-Tfng - 0x406d20b9: 621, // shi-Tfng-MA - 0x40a00000: 622, // si - 0x40a000b2: 623, // si-LK - 0x41000000: 624, // sk - 0x41000110: 625, // sk-SK - 0x41400000: 626, // sl - 0x4140010e: 627, // sl-SI - 0x41a00000: 628, // sma - 0x41b00000: 629, // smi - 0x41c00000: 630, // smj - 0x41d00000: 631, // smn - 0x41d00071: 632, // smn-FI - 0x42000000: 633, // sms - 0x42100000: 634, // sn - 0x42100163: 635, // sn-ZW - 0x42700000: 636, // so - 0x42700061: 637, // so-DJ - 0x4270006e: 638, // so-ET - 0x427000a3: 639, // so-KE - 0x42700114: 640, // so-SO - 0x42f00000: 641, // sq - 0x42f00026: 642, // sq-AL - 0x42f000c1: 643, // sq-MK - 0x42f0014c: 644, // sq-XK - 0x43000000: 645, // sr - 0x4301e000: 646, // sr-Cyrl - 0x4301e032: 647, // sr-Cyrl-BA - 0x4301e0bc: 648, // sr-Cyrl-ME - 0x4301e104: 649, // sr-Cyrl-RS - 0x4301e14c: 650, // sr-Cyrl-XK - 0x43052000: 651, // sr-Latn - 0x43052032: 652, // sr-Latn-BA - 0x430520bc: 653, // sr-Latn-ME - 0x43052104: 654, // sr-Latn-RS - 0x4305214c: 655, // sr-Latn-XK - 0x43500000: 656, // ss - 0x43800000: 657, // ssy - 0x43900000: 658, // st - 0x44200000: 659, // sv - 0x44200030: 660, // sv-AX - 0x44200071: 661, // sv-FI - 0x4420010b: 662, // sv-SE - 0x44300000: 663, // sw - 0x4430004a: 664, // sw-CD - 0x443000a3: 665, // sw-KE - 0x4430012e: 666, // sw-TZ - 0x44300130: 667, // sw-UG - 0x44c00000: 668, // syr - 0x44e00000: 669, // ta - 0x44e00098: 670, // ta-IN - 0x44e000b2: 671, // ta-LK - 0x44e000cf: 672, // ta-MY - 0x44e0010c: 673, // ta-SG - 0x45f00000: 674, // te - 0x45f00098: 675, // te-IN - 0x46200000: 676, // teo - 0x462000a3: 677, // teo-KE - 0x46200130: 678, // teo-UG - 0x46900000: 679, // th - 0x46900122: 680, // th-TH - 0x46d00000: 681, // ti - 0x46d0006c: 682, // ti-ER - 0x46d0006e: 683, // ti-ET - 0x46f00000: 684, // tig - 0x47400000: 685, // tk - 0x47400126: 686, // tk-TM - 0x47e00000: 687, // tn - 0x48000000: 688, // to - 0x48000128: 689, // to-TO - 0x48800000: 690, // tr - 0x4880005c: 691, // tr-CY - 0x4880012a: 692, // tr-TR - 0x48c00000: 693, // ts - 0x4a200000: 694, // twq - 0x4a2000d3: 695, // twq-NE - 0x4a700000: 696, // tzm - 0x4a7000b9: 697, // tzm-MA - 0x4aa00000: 698, // ug - 0x4aa00052: 699, // ug-CN - 0x4ac00000: 700, // uk - 0x4ac0012f: 701, // uk-UA - 0x4b200000: 702, // ur - 0x4b200098: 703, // ur-IN - 0x4b2000e7: 704, // ur-PK - 0x4ba00000: 705, // uz - 0x4ba05000: 706, // uz-Arab - 0x4ba05023: 707, // uz-Arab-AF - 0x4ba1e000: 708, // uz-Cyrl - 0x4ba1e136: 709, // uz-Cyrl-UZ - 0x4ba52000: 710, // uz-Latn - 0x4ba52136: 711, // uz-Latn-UZ - 0x4bc00000: 712, // vai - 0x4bc52000: 713, // vai-Latn - 0x4bc520b3: 714, // vai-Latn-LR - 0x4bcd9000: 715, // vai-Vaii - 0x4bcd90b3: 716, // vai-Vaii-LR - 0x4be00000: 717, // ve - 0x4c100000: 718, // vi - 0x4c10013d: 719, // vi-VN - 0x4c700000: 720, // vo - 0x4c700001: 721, // vo-001 - 0x4ca00000: 722, // vun - 0x4ca0012e: 723, // vun-TZ - 0x4cc00000: 724, // wa - 0x4cd00000: 725, // wae - 0x4cd0004d: 726, // wae-CH - 0x4e300000: 727, // wo - 0x4f000000: 728, // xh - 0x4f900000: 729, // xog - 0x4f900130: 730, // xog-UG - 0x50700000: 731, // yav - 0x50700051: 732, // yav-CM - 0x51000000: 733, // yi - 0x51000001: 734, // yi-001 - 0x51600000: 735, // yo - 0x5160003a: 736, // yo-BJ - 0x516000d5: 737, // yo-NG - 0x51d00000: 738, // yue - 0x51d0008c: 739, // yue-HK - 0x52600000: 740, // zgh - 0x526000b9: 741, // zgh-MA - 0x52700000: 742, // zh - 0x52734000: 743, // zh-Hans - 0x52734052: 744, // zh-Hans-CN - 0x5273408c: 745, // zh-Hans-HK - 0x527340c5: 746, // zh-Hans-MO - 0x5273410c: 747, // zh-Hans-SG - 0x52735000: 748, // zh-Hant - 0x5273508c: 749, // zh-Hant-HK - 0x527350c5: 750, // zh-Hant-MO - 0x5273512d: 751, // zh-Hant-TW - 0x52c00000: 752, // zu - 0x52c00160: 753, // zu-ZA -} - -// Total table size 4592 bytes (4KiB); checksum: C25F8AFF diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index f1012c9525..b939c89f14 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -2,151 +2,42 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:generate go run gen.go gen_common.go -output tables.go -//go:generate go run gen_index.go +//go:generate go run gen.go -output tables.go -// Package language implements BCP 47 language tags and related functionality. -// -// The Tag type, which is used to represent languages, is agnostic to the -// meaning of its subtags. Tags are not fully canonicalized to preserve -// information that may be valuable in certain contexts. As a consequence, two -// different tags may represent identical languages. -// -// Initializing language- or locale-specific components usually consists of -// two steps. The first step is to select a display language based on the -// preferred languages of the user and the languages supported by an application. -// The second step is to create the language-specific services based on -// this selection. Each is discussed in more details below. -// -// Matching preferred against supported languages -// -// An application may support various languages. This list is typically limited -// by the languages for which there exists translations of the user interface. -// Similarly, a user may provide a list of preferred languages which is limited -// by the languages understood by this user. -// An application should use a Matcher to find the best supported language based -// on the user's preferred list. -// Matchers are aware of the intricacies of equivalence between languages. -// The default Matcher implementation takes into account things such as -// deprecated subtags, legacy tags, and mutual intelligibility between scripts -// and languages. -// -// A Matcher for English, Australian English, Danish, and standard Mandarin can -// be defined as follows: -// -// var matcher = language.NewMatcher([]language.Tag{ -// language.English, // The first language is used as fallback. -// language.MustParse("en-AU"), -// language.Danish, -// language.Chinese, -// }) -// -// The following code selects the best match for someone speaking Spanish and -// Norwegian: -// -// preferred := []language.Tag{ language.Spanish, language.Norwegian } -// tag, _, _ := matcher.Match(preferred...) -// -// In this case, the best match is Danish, as Danish is sufficiently a match to -// Norwegian to not have to fall back to the default. -// See ParseAcceptLanguage on how to handle the Accept-Language HTTP header. -// -// Selecting language-specific services -// -// One should always use the Tag returned by the Matcher to create an instance -// of any of the language-specific services provided by the text repository. -// This prevents the mixing of languages, such as having a different language for -// messages and display names, as well as improper casing or sorting order for -// the selected language. -// Using the returned Tag also allows user-defined settings, such as collation -// order or numbering system to be transparently passed as options. -// -// If you have language-specific data in your application, however, it will in -// most cases suffice to use the index returned by the matcher to identify -// the user language. -// The following loop provides an alternative in case this is not sufficient: -// -// supported := map[language.Tag]data{ -// language.English: enData, -// language.MustParse("en-AU"): enAUData, -// language.Danish: daData, -// language.Chinese: zhData, -// } -// tag, _, _ := matcher.Match(preferred...) -// for ; tag != language.Und; tag = tag.Parent() { -// if v, ok := supported[tag]; ok { -// return v -// } -// } -// return enData // should not reach here -// -// Repeatedly taking the Parent of the tag returned by Match will eventually -// match one of the tags used to initialize the Matcher. -// -// Canonicalization -// -// By default, only legacy and deprecated tags are converted into their -// canonical equivalent. All other information is preserved. This approach makes -// the confidence scores more accurate and allows matchers to distinguish -// between variants that are otherwise lost. -// -// As a consequence, two tags that should be treated as identical according to -// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The -// Matchers will handle such distinctions, though, and are aware of the -// equivalence relations. The CanonType type can be used to alter the -// canonicalization form. -// -// References -// -// BCP 47 - Tags for Identifying Languages -// http://tools.ietf.org/html/bcp47 -package language // import "golang.org/x/text/language" +package language // TODO: Remove above NOTE after: // - verifying that tables are dropped correctly (most notably matcher tables). import ( - "errors" - "fmt" "strings" -) -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" ) // Tag represents a BCP 47 language tag. It is used to specify an instance of a // specific language or locale. All language tag values are guaranteed to be // well-formed. -type Tag struct { - lang langID - region regionID - // TODO: we will soon run out of positions for script. Idea: instead of - // storing lang, region, and script codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - script scriptID - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' +type Tag compact.Tag - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) } +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + // Make is a convenience wrapper for Parse that omits the error. // In case of an error, a sensible default is returned. func Make(s string) Tag { @@ -163,25 +54,13 @@ func (c CanonType) Make(s string) Tag { // Raw returns the raw base language, script and region, without making an // attempt to infer their values. func (t Tag) Raw() (b Base, s Script, r Region) { - return Base{t.lang}, Script{t.script}, Region{t.region} -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.lang == a.lang && t.script == a.script && t.region == a.region + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} } // IsRoot returns true if t is equal to language "und". func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(und) -} - -// private reports whether the Tag consists solely of a private use tag. -func (t Tag) private() bool { - return t.str != "" && t.pVariant == 0 + return compact.Tag(t).IsRoot() } // CanonType can be used to enable or disable various types of canonicalization. @@ -233,73 +112,73 @@ const ( // canonicalize returns the canonicalized equivalent of the tag and // whether there was any change. -func (t Tag) canonicalize(c CanonType) (Tag, bool) { +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { if c == Raw { return t, false } changed := false if c&SuppressScript != 0 { - if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] { - t.script = 0 + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 changed = true } } if c&canonLang != 0 { for { - if l, aliasType := normLang(t.lang); l != t.lang { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { switch aliasType { - case langLegacy: + case language.Legacy: if c&Legacy != 0 { - if t.lang == _sh && t.script == 0 { - t.script = _Latn + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn } - t.lang = l + t.LangID = l changed = true } - case langMacro: + case language.Macro: if c&Macro != 0 { // We deviate here from CLDR. The mapping "nb" -> "no" // qualifies as a typical Macro language mapping. However, // for legacy reasons, CLDR maps "no", the macro language // code for Norwegian, to the dominant variant "nb". This // change is currently under consideration for CLDR as well. - // See http://unicode.org/cldr/trac/ticket/2698 and also - // http://unicode.org/cldr/trac/ticket/1790 for some of the + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the // practical implications. TODO: this check could be removed // if CLDR adopts this change. - if c&CLDR == 0 || t.lang != _nb { + if c&CLDR == 0 || t.LangID != _nb { changed = true - t.lang = l + t.LangID = l } } - case langDeprecated: + case language.Deprecated: if c&DeprecatedBase != 0 { - if t.lang == _mo && t.region == 0 { - t.region = _MD + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD } - t.lang = l + t.LangID = l changed = true // Other canonicalization types may still apply. continue } } - } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 { - t.lang = _nb + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb changed = true } break } } if c&DeprecatedScript != 0 { - if t.script == _Qaai { + if t.ScriptID == _Qaai { changed = true - t.script = _Zinh + t.ScriptID = _Zinh } } if c&DeprecatedRegion != 0 { - if r := normRegion(t.region); r != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { changed = true - t.region = r + t.RegionID = r } } return t, changed @@ -307,11 +186,20 @@ func (t Tag) canonicalize(c CanonType) (Tag, bool) { // Canonicalize returns the canonicalized equivalent of the tag. func (c CanonType) Canonicalize(t Tag) (Tag, error) { - t, changed := t.canonicalize(c) - if changed { - t.remakeString() + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil } return t, nil + } // Confidence indicates the level of certainty for a given return value. @@ -334,79 +222,38 @@ func (c Confidence) String() string { return confName[c] } -// remakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) remakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.lang.stringToBuf(buf[:]) - if t.script != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.script.String()) - } - if t.region != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.region.String()) - } - return n -} - // String returns the canonical string representation of the language tag. func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.script == 0 && t.region == 0 { - return t.lang.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err } // Base returns the base language of the language tag. If the base language is // unspecified, an attempt will be made to infer it from the context. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Base() (Base, Confidence) { - if t.lang != 0 { - return Base{t.lang}, Exact + if b := t.lang(); b != 0 { + return Base{b}, Exact } + tt := t.tag() c := High - if t.script == 0 && !(Region{t.region}).IsCountry() { + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { c = Low } - if tag, err := addTags(t); err == nil && tag.lang != 0 { - return Base{tag.lang}, c + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c } return Base{0}, No } @@ -419,35 +266,34 @@ func (t Tag) Base() (Base, Confidence) { // If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) // as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks // common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. -// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for // unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. // Note that an inferred script is never guaranteed to be the correct one. Latin is // almost exclusively used for Afrikaans, but Arabic has been used for some texts // in the past. Also, the script that is commonly used may change over time. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Script() (Script, Confidence) { - if t.script != 0 { - return Script{t.script}, Exact + if scr := t.script(); scr != 0 { + return Script{scr}, Exact } - sc, c := scriptID(_Zzzz), No - if t.lang < langNoIndexOffset { - if scr := scriptID(suppressScript[t.lang]); scr != 0 { - // Note: it is not always the case that a language with a suppress - // script value is only written in one script (e.g. kk, ms, pa). - if t.region == 0 { - return Script{scriptID(scr)}, High - } - sc, c = scr, High + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High } + sc, c = scr, High } - if tag, err := addTags(t); err == nil { - if tag.script != sc { - sc, c = tag.script, Low + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low } } else { - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil && tag.script != sc { - sc, c = tag.script, Low + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low } } return Script{sc}, c @@ -457,28 +303,31 @@ func (t Tag) Script() (Script, Confidence) { // infer a most likely candidate from the context. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Region() (Region, Confidence) { - if t.region != 0 { - return Region{t.region}, Exact + if r := t.region(); r != 0 { + return Region{r}, Exact } - if t, err := addTags(t); err == nil { - return Region{t.region}, Low // TODO: differentiate between high and low. + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. } - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil { - return Region{tag.region}, Low + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low } return Region{_ZZ}, No // TODO: return world instead of undetermined? } -// Variant returns the variants specified explicitly for this language tag. +// Variants returns the variants specified explicitly for this language tag. // or nil if no variant was specified. func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } v := []Variant{} - if int(t.pVariant) < int(t.pExt) { - for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; { - x, str = nextToken(str) - v = append(v, Variant{x}) - } + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) } return v } @@ -486,57 +335,13 @@ func (t Tag) Variants() []Variant { // Parent returns the CLDR parent of t. In CLDR, missing fields in data for a // specific language are substituted with fields from the parent language. // The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - t, _ = Raw.Compose(t.Raw()) - if t.region == 0 && t.script != 0 && t.lang != 0 { - base, _ := addTags(Tag{lang: t.lang}) - if base.script == t.script { - return Tag{lang: t.lang} - } - } - return t - } - if t.lang != 0 { - if t.region != 0 { - maxScript := t.script - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.script - } - - for i := range parents { - if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if regionID(r) == t.region { - return Tag{ - lang: t.lang, - script: scriptID(parents[i].script), - region: regionID(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != maxScript { - return Tag{lang: t.lang, script: maxScript} - } - return Tag{lang: t.lang} - } else if t.script != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != t.script { - return und - } - return Tag{lang: t.lang} - } - } - return und + return Tag(compact.Tag(t).Parent()) } // returns token t and the rest of the string. @@ -562,17 +367,8 @@ func (e Extension) String() string { // ParseExtension parses s as an extension and returns it on success. func ParseExtension(s string) (e Extension, err error) { - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return Extension{}, errSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return Extension{}, errSyntax - } - return Extension{string(scan.b)}, nil + ext, err := language.ParseExtension(s) + return Extension{ext}, err } // Type returns the one-byte extension type of e. It returns 0 for the zero @@ -593,22 +389,20 @@ func (e Extension) Tokens() []string { // false for ok if t does not have the requested extension. The returned // extension will be invalid in this case. func (t Tag) Extension(x byte) (ext Extension, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return Extension{ext}, true - } + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false } - return Extension{}, false + e, ok := t.tag().Extension(x) + return Extension{e}, ok } // Extensions returns all extensions of t. func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } e := []Extension{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) + for _, ext := range t.tag().Extensions() { e = append(e, Extension{ext}) } return e @@ -616,259 +410,105 @@ func (t Tag) Extensions() []Extension { // TypeForKey returns the type associated with the given key, where key and type // are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // TypeForKey will traverse the inheritance chain to get the correct value. func (t Tag) TypeForKey(key string) string { - if start, end, _ := t.findTypeForKey(key); end != start { - return t.str[start:end] + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } } - return "" + return t.tag().TypeForKey(key) } -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - // SetTypeForKey returns a new Tag with the key set to type, where key and type // are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // An empty value removes an existing pair with the same key. func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.private() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, end, _ := t.findTypeForKey(key) - if start != end { - // Remove key tag and leading '-'. - start -= 4 - - // Remove a possible empty extension. - if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, end, hasExt := t.findTypeForKey(key) - if start == end { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) - } - } - return t, nil + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err } -// findKeyAndType returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - // p points to the hyphen preceding the current token. - if p3 := p + 3; s[p3] == '-' { - // Found a key. - // Check whether we just processed the key that was requested. - if curKey == key { - return start, p, true - } - // Set to the next key and continue scanning type tokens. - curKey = s[p+1 : p3] - if curKey > key { - return p, p, true - } - // Start of the type token sequence. - start = p + 4 - // A type is at least 3 characters long. - p += 7 // 4 + 3 - } else { - // Attribute or type, which is at least 3 characters long. - p += 4 - } - // p points past the third character of a type or attribute. - max := p + 5 // maximum length of token plus hyphen. - if len(s) < max { - max = len(s) - } - for ; p < max && s[p] != '-'; p++ { - } - // Bail if we have exhausted all tokens or if the next token starts - // a new extension. - if p == len(s) || s[p+2] == '-' { - if curKey == key { - return start, p, true - } - return p, p, true - } - } -} +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags // CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository. The index will change over time -// and should not be stored in persistent storage. Extensions, except for the -// 'va' type of the 'u' extension, are ignored. It will return 0, false if no -// compact tag exists, where 0 is the index for the root language (Und). -func CompactIndex(t Tag) (index int, ok bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - b, s, r := t.Raw() - if len(t.str) > 0 { - if strings.HasPrefix(t.str, "x-") { - // We have no entries for user-defined tags. - return 0, false - } - if uint16(t.pVariant) != t.pExt { - // There are no tags with variants and an u-va type. - if t.TypeForKey("va") != "" { - return 0, false - } - t, _ = Raw.Compose(b, s, r, t.Variants()) - } else if _, ok := t.Extension('u'); ok { - // Strip all but the 'va' entry. - variant := t.TypeForKey("va") - t, _ = Raw.Compose(b, s, r) - t, _ = t.SetTypeForKey("va", variant) - } - if len(t.str) > 0 { - // We have some variants. - for i, s := range specialTags { - if s == t { - return i + 1, true - } - } - return 0, false - } - } - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - key := uint32(b.langID) << (8 + 12) - key |= uint32(s.scriptID) << 12 - key |= uint32(r.regionID) - x, ok := coreTags[key] - return int(x), ok +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact } +var root = language.Tag{} + // Base is an ISO 639 language code, used for encoding the base language // of a language tag. type Base struct { - langID + langID language.Language } // ParseBase parses a 2- or 3-letter ISO 639 code. // It returns a ValueError if s is a well-formed but unknown language identifier // or another error if another error occurred. func ParseBase(s string) (Base, error) { - if n := len(s); n < 2 || 3 < n { - return Base{}, errSyntax - } - var buf [3]byte - l, err := getLangID(buf[:copy(buf[:], s)]) + l, err := language.ParseBase(s) return Base{l}, err } +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + // Script is a 4-letter ISO 15924 code for representing scripts. // It is idiomatically represented in title case. type Script struct { - scriptID + scriptID language.Script } // ParseScript parses a 4-letter ISO 15924 code. // It returns a ValueError if s is a well-formed but unknown script identifier // or another error if another error occurred. func ParseScript(s string) (Script, error) { - if len(s) != 4 { - return Script{}, errSyntax - } - var buf [4]byte - sc, err := getScriptID(script, buf[:copy(buf[:], s)]) + sc, err := language.ParseScript(s) return Script{sc}, err } +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + // Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. type Region struct { - regionID + regionID language.Region } // EncodeM49 returns the Region for the given UN M.49 code. // It returns an error if r is not a valid code. func EncodeM49(r int) (Region, error) { - rid, err := getRegionM49(r) + rid, err := language.EncodeM49(r) return Region{rid}, err } @@ -876,62 +516,54 @@ func EncodeM49(r int) (Region, error) { // It returns a ValueError if s is a well-formed but unknown region identifier // or another error if another error occurred. func ParseRegion(s string) (Region, error) { - if n := len(s); n < 2 || 3 < n { - return Region{}, errSyntax - } - var buf [3]byte - r, err := getRegionID(buf[:copy(buf[:], s)]) + r, err := language.ParseRegion(s) return Region{r}, err } +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.String() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + // IsCountry returns whether this region is a country or autonomous area. This // includes non-standard definitions from CLDR. func (r Region) IsCountry() bool { - if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK { - return false - } - return true + return r.regionID.IsCountry() } // IsGroup returns whether this region defines a collection of regions. This // includes non-standard definitions from CLDR. func (r Region) IsGroup() bool { - if r.regionID == 0 { - return false - } - return int(regionInclusion[r.regionID]) < len(regionContainment) + return r.regionID.IsGroup() } // Contains returns whether Region c is contained by Region r. It returns true // if c == r. func (r Region) Contains(c Region) bool { - return r.regionID.contains(c.regionID) + return r.regionID.Contains(c.regionID) } -func (r regionID) contains(c regionID) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - // TLD returns the country code top-level domain (ccTLD). UK is returned for GB. // In all other cases it returns either the region itself or an error. // @@ -940,25 +572,15 @@ var errNoTLD = errors.New("language: region is not a valid ccTLD") // region will already be canonicalized it was obtained from a Tag that was // obtained using any of the default methods. func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r.regionID == _GB { - r = Region{_UK} - } - if (r.typ() & ccTLD) == 0 { - return Region{}, errNoTLD - } - return r, nil + tld, err := r.regionID.TLD() + return Region{tld}, err } // Canonicalize returns the region or a possible replacement if the region is // deprecated. It will not return a replacement for deprecated regions that // are split into multiple regions. func (r Region) Canonicalize() Region { - if cr := normRegion(r.regionID); cr != 0 { - return Region{cr} - } - return r + return Region{r.regionID.Canonicalize()} } // Variant represents a registered variant of a language as defined by BCP 47. @@ -969,11 +591,8 @@ type Variant struct { // ParseVariant parses and returns a Variant. An error is returned if s is not // a valid variant. func ParseVariant(s string) (Variant, error) { - s = strings.ToLower(s) - if _, ok := variantIndex[s]; ok { - return Variant{s}, nil - } - return Variant{}, mkErrInvalid([]byte(s)) + v, err := language.ParseVariant(s) + return Variant{v.String()}, err } // String returns the string representation of the variant. diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index 63bc744a39..f734921349 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -4,7 +4,12 @@ package language -import "errors" +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) // A MatchOption configures a Matcher. type MatchOption func(*matcher) @@ -16,6 +21,29 @@ func PreferSameScript(preferSame bool) MatchOption { return func(m *matcher) { m.preferSameScript = preferSame } } +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + // Matcher is the interface that wraps the Match method. // // Match returns the best match for any of the given tags, along with @@ -51,12 +79,13 @@ func NewMatcher(t []Tag, options ...MatchOption) Matcher { } func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag match, w, c := m.getBest(want...) if match != nil { - t, index = match.tag, match.index + tt, index = match.tag, match.index } else { // TODO: this should be an option - t = m.default_.tag + tt = m.default_.tag if m.preferSameScript { outer: for _, w := range want { @@ -68,7 +97,7 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { } for i, h := range m.supported { if script.scriptID == h.maxScript { - t, index = h.tag, i + tt, index = h.tag, i break outer } } @@ -76,239 +105,45 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { } // TODO: select first language tag based on script. } - if w.region != 0 && t.region != 0 && t.region.contains(w.region) { - t, _ = Raw.Compose(t, Region{w.region}) + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } } // Copy options from the user-provided tag into the result tag. This is hard // to do after the fact, so we do it here. // TODO: add in alternative variants to -u-va-. // TODO: add preferred region to -u-rg-. - // TODO: add other extensions. Merge with existing extensions. - if u, ok := w.Extension('u'); ok { - t, _ = Raw.Compose(t, u) - } - return t, index, c -} - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id langID) { - if t.lang == 0 { - t.lang = id - } -} - -func (t *Tag) setUndefinedScript(id scriptID) { - if t.script == 0 { - t.script = id - } -} - -func (t *Tag) setUndefinedRegion(id regionID) { - if t.region == 0 || t.region.contains(id) { - t.region = id + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() } + return makeTag(tt), index, c } // ErrMissingLikelyTagsData indicates no information was available // to compute likely values of missing tags. var ErrMissingLikelyTagsData = errors.New("missing likely tags data") -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns a ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.remakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if langID(x.lang) == t.lang && scriptID(x.script) == t.script { - t.region = regionID(x.region) - } - return true - } - return false -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.private() { - return t, nil - } - if t.script != 0 && t.region != 0 { - if t.lang != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.region : t.region+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if scriptID(x.script) == t.script { - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - } - if t.lang != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.script != 0 { - for _, x := range list { - if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(regionID(x.region)) - return t, nil - } - } - } else if t.region != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) { - tt.region = regionID(x.region) - tt.setUndefinedScript(scriptID(x.script)) - goodScript = goodScript && tt.script == scriptID(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.script = tt.script - } - } - } - } - } else { - // Search matches for und-script. - if t.script != 0 { - x := likelyScript[t.script] - if x.region != 0 { - t.setUndefinedRegion(regionID(x.region)) - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.region != 0 { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - t.region = regionID(x.region) - } - } else { - x := likelyRegion[t.region] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(scriptID(x.script)) - t.setUndefinedRegion(regionID(x.region)) - } - specializeRegion(&t) - if t.lang == 0 { - t.lang = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.lang = id.lang - t.script = id.script - t.region = id.region -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.remakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {lang: t.lang}, - {lang: t.lang, region: t.region}, - {lang: t.lang, script: t.script}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } // Tag Matching // CLDR defines an algorithm for finding the best match between two sets of language // tags. The basic algorithm defines how to score a possible match and then find // the match with the best score -// (see http://www.unicode.org/reports/tr35/#LanguageMatching). +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). // Using scoring has several disadvantages. The scoring obfuscates the importance of // the various factors considered, making the algorithm harder to understand. Using // scoring also requires the full score to be computed for each pair of tags. @@ -331,8 +166,9 @@ func minimizeTags(t Tag) (Tag, error) { // 1) compute the match between the two tags. // 2) if the match is better than the previous best match, replace it // with the new match. (see next section) -// b) if the current best match is above a certain threshold, return this -// match without proceeding to the next tag in "desired". [See Note 1] +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. // 3) If the best match so far is below a certain threshold, return "default". // // Ranking: @@ -381,9 +217,6 @@ func minimizeTags(t Tag) (Tag, error) { // found wins. // // Notes: -// [1] Note that even if we may not have a perfect match, if a match is above a -// certain threshold, it is considered a better match than any other match -// to a tag later in the list of preferred language tags. // [2] In practice, as matching of Exact is done in a separate phase from // matching the other levels, we reuse the Exact level to mean MaxExact in // the second phase. As a consequence, we only need the levels defined by @@ -421,7 +254,7 @@ func minimizeTags(t Tag) (Tag, error) { type matcher struct { default_ *haveTag supported []*haveTag - index map[langID]*matchHeader + index map[language.Language]*matchHeader passSettings bool preferSameScript bool } @@ -429,14 +262,14 @@ type matcher struct { // matchHeader has the lists of tags for exact matches and matches based on // maximized and canonicalized tags for a given language. type matchHeader struct { - exact []*haveTag - max []*haveTag + haveTags []*haveTag + original bool } // haveTag holds a supported Tag and its maximized script and region. The maximized // or canonicalized language is not stored as it is not needed during matching. type haveTag struct { - tag Tag + tag language.Tag // index of this tag in the original list of supported tags. index int @@ -446,37 +279,37 @@ type haveTag struct { conf Confidence // Maximized region and script. - maxRegion regionID - maxScript scriptID + maxRegion language.Region + maxScript language.Script // altScript may be checked as an alternative match to maxScript. If altScript // matches, the confidence level for this match is Low. Theoretically there // could be multiple alternative scripts. This does not occur in practice. - altScript scriptID + altScript language.Script // nextMax is the index of the next haveTag with the same maximized tags. nextMax uint16 } -func makeHaveTag(tag Tag, index int) (haveTag, langID) { +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { max := tag - if tag.lang != 0 { - max, _ = max.canonicalize(All) - max, _ = addTags(max) - max.remakeString() + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() } - return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID } // altScript returns an alternative script that may match the given script with // a low confidence. At the moment, the langMatch data allows for at most one // script to map to another and we rely on this to keep the code simple. -func altScript(l langID, s scriptID) scriptID { +func altScript(l language.Language, s language.Script) language.Script { for _, alt := range matchScript { // TODO: also match cases where language is not the same. - if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) && - scriptID(alt.haveScript) == s { - return scriptID(alt.wantScript) + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) } } return 0 @@ -485,34 +318,32 @@ func altScript(l langID, s scriptID) scriptID { // addIfNew adds a haveTag to the list of tags only if it is a unique tag. // Tags that have the same maximized values are linked by index. func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact // Don't add new exact matches. - for _, v := range h.exact { - if v.tag.equalsRest(n.tag) { + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { return } } - if exact { - h.exact = append(h.exact, &n) - } // Allow duplicate maximized tags, but create a linked list to allow quickly // comparing the equivalents and bail out. - for i, v := range h.max { + for i, v := range h.haveTags { if v.maxScript == n.maxScript && v.maxRegion == n.maxRegion && - v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() { - for h.max[i].nextMax != 0 { - i = int(h.max[i].nextMax) + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) } - h.max[i].nextMax = uint16(len(h.max)) + h.haveTags[i].nextMax = uint16(len(h.haveTags)) break } } - h.max = append(h.max, &n) + h.haveTags = append(h.haveTags, &n) } // header returns the matchHeader for the given language. It creates one if // it doesn't already exist. -func (m *matcher) header(l langID) *matchHeader { +func (m *matcher) header(l language.Language) *matchHeader { if h := m.index[l]; h != nil { return h } @@ -536,7 +367,7 @@ func toConf(d uint8) Confidence { // for a given tag. func newMatcher(supported []Tag, options []MatchOption) *matcher { m := &matcher{ - index: make(map[langID]*matchHeader), + index: make(map[language.Language]*matchHeader), preferSameScript: true, } for _, o := range options { @@ -549,40 +380,41 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // Add supported languages to the index. Add exact matches first to give // them precedence. for i, tag := range supported { - pair, _ := makeHaveTag(tag, i) - m.header(tag.lang).addIfNew(pair, true) + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) m.supported = append(m.supported, &pair) } - m.default_ = m.header(supported[0].lang).exact[0] + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. for i, tag := range supported { - pair, max := makeHaveTag(tag, i) - if max != tag.lang { - m.header(max).addIfNew(pair, false) + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) } } - // TODO: include alt script. - // - don't replace regions, but allow regions to be made more specific. - // update is used to add indexes in the map for equivalent languages. - // If force is true, the update will also apply to derived entries. To - // avoid applying a "transitive closure", use false. - update := func(want, have uint16, conf Confidence, force bool) { - if hh := m.index[langID(have)]; hh != nil { - if !force && len(hh.exact) == 0 { + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { return } - hw := m.header(langID(want)) - for _, ht := range hh.max { + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { v := *ht if conf < v.conf { v.conf = conf } v.nextMax = 0 // this value needs to be recomputed if v.altScript != 0 { - v.altScript = altScript(langID(want), v.maxScript) + v.altScript = altScript(language.Language(want), v.maxScript) } - hw.addIfNew(v, conf == Exact && len(hh.exact) > 0) + hw.addIfNew(v, conf == Exact && hh.original) } } } @@ -590,9 +422,9 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // Add entries for languages with mutual intelligibility as defined by CLDR's // languageMatch data. for _, ml := range matchLang { - update(ml.want, ml.have, toConf(ml.distance), false) + update(ml.want, ml.have, toConf(ml.distance)) if !ml.oneway { - update(ml.have, ml.want, toConf(ml.distance), false) + update(ml.have, ml.want, toConf(ml.distance)) } } @@ -601,127 +433,157 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // First we match deprecated equivalents. If they are perfect equivalents // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. - for i, lm := range langAliasMap { - if lm.from == _sh { - continue - } - + for i, lm := range language.AliasMap { // If deprecated codes match and there is no fiddling with the script or // or region, we consider it an exact match. conf := Exact - if langAliasTypes[i] != langMacro { - if !isExactEquivalent(langID(lm.from)) { + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { conf = High } - update(lm.to, lm.from, conf, true) + update(lm.To, lm.From, conf) } - update(lm.from, lm.to, conf, true) + update(lm.From, lm.To, conf) } return m } // getBest gets the best matching tag in m for any of the given tags, taking into // account the order of preference of the given tags. -func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { best := bestMatch{} - for _, w := range want { - var max Tag + for i, ww := range want { + w := ww.tag() + var max language.Tag // Check for exact match first. - h := m.index[w.lang] - if w.lang != 0 { - // Base language is defined. + h := m.index[w.LangID] + if w.LangID != 0 { if h == nil { continue } - for i := range h.exact { - have := h.exact[i] - if have.tag.equalsRest(w) { - return have, w, Exact - } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID } - max, _ = w.canonicalize(Legacy | Deprecated) - max, _ = addTags(max) + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() } else { // Base language is not defined. if h != nil { - for i := range h.exact { - have := h.exact[i] - if have.tag.equalsRest(w) { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { return have, w, Exact } } } - if w.script == 0 && w.region == 0 { + if w.ScriptID == 0 && w.RegionID == 0 { // We skip all tags matching und for approximate matching, including // private tags. continue } - max, _ = addTags(w) - if h = m.index[max.lang]; h == nil { + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { continue } } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } // Check for match based on maximized tag. - for i := range h.max { - have := h.max[i] - best.update(have, w, max.script, max.region) + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) if best.conf == Exact { for have.nextMax != 0 { - have = h.max[have.nextMax] - best.update(have, w, max.script, max.region) + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) } - return best.have, best.want, High + return best.have, best.want, best.conf } } } if best.conf <= No { if len(want) != 0 { - return nil, want[0], No + return nil, want[0].tag(), No } - return nil, Tag{}, No + return nil, language.Tag{}, No } return best.have, best.want, best.conf } // bestMatch accumulates the best match so far. type bestMatch struct { - have *haveTag - want Tag - conf Confidence + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool // Cached results from applying tie-breaking rules. origLang bool origReg bool + paradigmReg bool regGroupDist uint8 - regDist uint8 origScript bool - parentDist uint8 // 255 if have is not an ancestor of want tag. } // update updates the existing best match if the new pair is considered to be a -// better match. -// To determine if the given pair is a better match, it first computes the rough -// confidence level. If this surpasses the current match, it will replace it and -// update the tie-breaker rule cache. If there is a tie, it proceeds with applying -// a series of tie-breaker rules. If there is no conclusive winner after applying -// the tie-breaker rules, it leaves the current match as the preferred match. -func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID) { +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the nothing that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { // Bail if the maximum attainable confidence is below that of the current best match. c := have.conf if c < m.conf { return } - if have.maxScript != maxScript { + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { // There is usually very little comprehension between different scripts. - // In a few cases there may still be Low comprehension. This possibility is - // pre-computed and stored in have.altScript. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. if Low < m.conf || have.altScript != maxScript { return } c = Low } else if have.maxRegion != maxRegion { - // There is usually a small difference between languages across regions. - // We use the region distance (below) to disambiguate between equal matches. if High < c { + // There is usually a small difference between languages across regions. c = High } } @@ -740,7 +602,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion // Tie-breaker rules: // We prefer if the pre-maximized language was specified and identical. - origLang := have.tag.lang == tag.lang && tag.lang != 0 + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 if !beaten && m.origLang != origLang { if m.origLang { return @@ -748,16 +610,8 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - regGroupDist := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang) - if !beaten && m.regGroupDist != regGroupDist { - if regGroupDist > m.regGroupDist { - return - } - beaten = true - } - // We prefer if the pre-maximized region was specified and identical. - origReg := have.tag.region == tag.region && tag.region != 0 + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 if !beaten && m.origReg != origReg { if m.origReg { return @@ -765,31 +619,24 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - // TODO: remove the region distance rule. Region distance has been replaced - // by the region grouping rule. For now we leave it as it still seems to - // have a net positive effect when applied after the grouping rule. - // Possible solutions: - // - apply the primary locale rule first to effectively disable region - // region distance if groups are defined. - // - express the following errors in terms of grouping (if possible) - // - find another method of handling the following cases. - // maximization of legacy: find mo in - // "sr-Cyrl, sr-Latn, ro, ro-MD": have ro; want ro-MD (High) - // region distance French: find fr-US in - // "en, fr, fr-CA, fr-CH": have fr; want fr-CA (High) + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } - // Next we prefer smaller distances between regions, as defined by - // regionDist. - regDist := uint8(regionDistance(have.maxRegion, maxRegion)) - if !beaten && m.regDist != regDist { - if regDist > m.regDist { + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { return } beaten = true } // Next we prefer if the pre-maximized script was specified and identical. - origScript := have.tag.script == tag.script && tag.script != 0 + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 if !beaten && m.origScript != origScript { if m.origScript { return @@ -797,120 +644,64 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - // Finally we prefer tags which have a closer parent relationship. - // TODO: the parent relationship no longer seems necessary. It doesn't hurt - // to leave it in as the final tie-breaker, though, especially until the - // grouping data has further matured. - parentDist := parentDistance(have.tag.region, tag) - if !beaten && m.parentDist != parentDist { - if parentDist > m.parentDist { - return - } - beaten = true - } - // Update m to the newly found best match. if beaten { m.have = have m.want = tag m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup m.origLang = origLang m.origReg = origReg + m.paradigmReg = paradigmReg m.origScript = origScript m.regGroupDist = regGroupDist - m.regDist = regDist - m.parentDist = parentDist } } -// parentDistance returns the number of times Parent must be called before the -// regions match. It is assumed that it has already been checked that lang and -// script are identical. If haveRegion does not occur in the ancestor chain of -// tag, it returns 255. -func parentDistance(haveRegion regionID, tag Tag) uint8 { - p := tag.Parent() - d := uint8(1) - for haveRegion != p.region { - if p.region == 0 { - return 255 +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true } - p = p.Parent() - d++ } - return d + return false } // regionGroupDist computes the distance between two regions based on their // CLDR grouping. -func regionGroupDist(a, b regionID, script scriptID, lang langID) uint8 { +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + aGroup := uint(regionToGroups[a]) << 1 bGroup := uint(regionToGroups[b]) << 1 for _, ri := range matchRegion { - if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { group := uint(1 << (ri.group &^ 0x80)) if 0x80&ri.group == 0 { if aGroup&bGroup&group != 0 { // Both regions are in the group. - return ri.distance + return ri.distance, ri.distance == defaultDistance } } else { if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. - return ri.distance + return ri.distance, ri.distance == defaultDistance } } } } - const defaultDistance = 4 - return defaultDistance -} - -// regionDistance computes the distance between two regions based on the -// distance in the graph of region containments as defined in CLDR. It iterates -// over increasingly inclusive sets of groups, represented as bit vectors, until -// the source bit vector has bits in common with the destination vector. -func regionDistance(a, b regionID) int { - if a == b { - return 0 - } - p, q := regionInclusion[a], regionInclusion[b] - if p < nRegionGroups { - p, q = q, p - } - set := regionInclusionBits - if q < nRegionGroups && set[p]&(1< 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] + return defaultDistance, true } // equalsRest compares everything except the language. -func (a Tag) equalsRest(b Tag) bool { +func equalsRest(a, b language.Tag) bool { // TODO: don't include extensions in this comparison. To do this efficiently, // though, we should handle private tags separately. - return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr() + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() } // isExactEquivalent returns true if canonicalizing the language will not alter // the script or region of a tag. -func isExactEquivalent(l langID) bool { +func isExactEquivalent(l language.Language) bool { for _, o := range notEquivalent { if o == l { return false @@ -919,15 +710,26 @@ func isExactEquivalent(l langID) bool { return true } -var notEquivalent []langID +var notEquivalent []language.Language func init() { // Create a list of all languages for which canonicalization may alter the // script or region. - for _, lm := range langAliasMap { - tag := Tag{lang: langID(lm.from)} - if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 { - notEquivalent = append(notEquivalent, langID(lm.from)) + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) } } } diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go index cfa28f56e2..11acfd8856 100644 --- a/vendor/golang.org/x/text/language/parse.go +++ b/vendor/golang.org/x/text/language/parse.go @@ -5,216 +5,21 @@ package language import ( - "bytes" "errors" - "fmt" - "sort" "strconv" "strings" - "golang.org/x/text/internal/tag" + "golang.org/x/text/internal/language" ) -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// errSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var errSyntax = errors.New("language: tag is not well-formed") - // ValueError is returned by any of the parsing functions when the // input is well-formed but the respective subtag is not recognized // as a valid value. -type ValueError struct { - v [8]byte -} +type ValueError interface { + error -func mkErrInvalid(s []byte) error { - var e ValueError - copy(e.v[:], s) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} - -func (s *scanner) setError(e error) { - if s.err == nil || (e == errSyntax && s.err != errSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - if end < cap(s.b) { - b := make([]byte, len(s.b)+diff) - copy(b, s.b[:oldStart]) - copy(b[end:], s.b[oldEnd:]) - s.b = b - } else { - s.b = append(s.b[end:], s.b[oldEnd:]...) - } - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.setError(errSyntax) - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(errSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(errSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end + // Subtag returns the subtag for which the error occurred. + Subtag() string } // Parse parses the given BCP 47 string and returns a valid Tag. If parsing @@ -223,7 +28,7 @@ func (s *scanner) acceptMinSize(min int) (end int) { // ValueError. The Tag returned in this case is just stripped of the unknown // value. All other values are preserved. It accepts tags in the BCP 47 format // and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // The resulting tag is canonicalized using the default canonicalization type. func Parse(s string) (t Tag, err error) { return Default.Parse(s) @@ -235,327 +40,18 @@ func Parse(s string) (t Tag, err error) { // ValueError. The Tag returned in this case is just stripped of the unknown // value. All other values are preserved. It accepts tags in the BCP 47 format // and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the the canonicalization type c. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. func (c CanonType) Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return und, errSyntax + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err } - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } - } - scan := makeScannerString(s) - t, err = parse(&scan, s) - t, changed := t.canonicalize(c) + tt, changed := canonicalize(c, tt) if changed { - t.remakeString() + tt.RemakeString() } - return t, err -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, errSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return und, errSyntax - } else { // the usual case - t, end = parseTag(scan) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(errSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.lang, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.lang.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, - tags are equivalent - // to a tag of the form . - lang, e := getLangID(scan.token) - if lang != 0 { - t.lang = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 - } - scan.gobble(e) - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.script, e = getScriptID(script, scan.token) - if t.script == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.region, e = getRegionID(scan.token) - if t.region == 0 { - scan.gobble(e) - } else { - scan.replace(t.region.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(mkErrInvalid(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort [][]byte - -func (b bytesSort) Len() int { - return len(b) -} - -func (b bytesSort) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bytesSort) Less(i, j int) bool { - return bytes.Compare(b[i], b[j]) == -1 -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(errSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) - } - sort.Sort(bytesSort(exts)) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort(attrs)) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - keyEnd := scan.end - end = scan.acceptMinSize(3) - // TODO: check key value validity - if keyEnd == end || bytes.Compare(key, last) != 1 { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart, keyEnd := scan.start, scan.end - end = scan.acceptMinSize(3) - if keyEnd != end { - keys = append(keys, scan.b[keyStart:end]) - } else { - scan.setError(errSyntax) - end = keyStart - } - } - sort.Sort(bytesSort(keys)) - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], bytes.Join(keys, separator)) - break - } - } - case 't': - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end + return makeTag(tt), err } // Compose creates a Tag from individual parts, which may be of type Tag, Base, @@ -563,10 +59,11 @@ func parseExtension(scan *scanner) int { // Base, Script or Region or slice of type Variant or Extension is passed more // than once, the latter will overwrite the former. Variants and Extensions are // accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using the Default CanonType. If one or more errors are -// encountered, one of the errors is returned. +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. func Compose(part ...interface{}) (t Tag, err error) { return Default.Compose(part...) } @@ -576,196 +73,68 @@ func Compose(part ...interface{}) (t Tag, err error) { // Base, Script or Region or slice of type Variant or Extension is passed more // than once, the latter will overwrite the former. Variants and Extensions are // accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using CanonType c. If one or more errors are encountered, -// one of the errors is returned. +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { - var b builder - if err = b.update(part...); err != nil { + var b language.Builder + if err = update(&b, part...); err != nil { return und, err } - t, _ = b.tag.canonicalize(c) - - if len(b.ext) > 0 || len(b.variant) > 0 { - sort.Sort(sortVariant(b.variant)) - sort.Strings(b.ext) - if b.private != "" { - b.ext = append(b.ext, b.private) - } - n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variant...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.ext...) - t.str = string(buf[:p]) - } else if b.private != "" { - t.str = b.private - t.remakeString() - } - return -} - -type builder struct { - tag Tag - - private string // the x extension - ext []string - variant []string - - err error -} - -func (b *builder) addExt(e string) { - if e == "" { - } else if e[0] == 'x' { - b.private = e - } else { - b.ext = append(b.ext, e) - } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err } var errInvalidArgument = errors.New("invalid Extension or Variant") -func (b *builder) update(part ...interface{}) (err error) { - replace := func(l *[]string, s string, eq func(a, b string) bool) bool { - if s == "" { - b.err = errInvalidArgument - return true - } - for i, v := range *l { - if eq(v, s) { - (*l)[i] = s - return true - } - } - return false - } +func update(b *language.Builder, part ...interface{}) (err error) { for _, x := range part { switch v := x.(type) { case Tag: - b.tag.lang = v.lang - b.tag.region = v.region - b.tag.script = v.script - if v.str != "" { - b.variant = nil - for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; { - x, s = nextToken(s) - b.variant = append(b.variant, x) - } - b.ext, b.private = nil, "" - for i, e := int(v.pExt), ""; i < len(v.str); { - i, e = getExtension(v.str, i) - b.addExt(e) - } - } + b.SetTag(v.tag()) case Base: - b.tag.lang = v.langID + b.Tag.LangID = v.langID case Script: - b.tag.script = v.scriptID + b.Tag.ScriptID = v.scriptID case Region: - b.tag.region = v.regionID + b.Tag.RegionID = v.regionID case Variant: - if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) { - b.variant = append(b.variant, v.variant) + if v.variant == "" { + err = errInvalidArgument + break } + b.AddVariant(v.variant) case Extension: - if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) { - b.addExt(v.s) + if v.s == "" { + err = errInvalidArgument + break } + b.SetExt(v.s) case []Variant: - b.variant = nil - for _, x := range v { - b.update(x) + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) } case []Extension: - b.ext, b.private = nil, "" + b.ClearExtensions() for _, e := range v { - b.update(e) + b.SetExt(e.s) } // TODO: support parsing of raw strings based on morphology or just extensions? case error: - err = v - } - } - return -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariant []string - -func (s sortVariant) Len() int { - return len(s) -} - -func (s sortVariant) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariant) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} - -func findExt(list []string, x byte) int { - for i, e := range list { - if e[0] == x { - return i - } - } - return -1 -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p + if v != nil { + err = v } - p += 3 - } else { - p++ } } - return len(s) + return } var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") -// ParseAcceptLanguage parses the contents of a Accept-Language header as +// ParseAcceptLanguage parses the contents of an Accept-Language header as // defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and // a list of corresponding quality weights. It is more permissive than RFC 2616 // and may return non-nil slices even if the input is not valid. @@ -788,7 +157,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { if !ok { return nil, nil, err } - t = Tag{lang: id} + t = makeTag(language.Tag{LangID: id}) } // Scan the optional weight. @@ -830,9 +199,9 @@ func split(s string, c byte) (head, tail string) { return strings.TrimSpace(s), "" } -// Add hack mapping to deal with a small number of cases that that occur +// Add hack mapping to deal with a small number of cases that occur // in Accept-Language (with reasonable frequency). -var acceptFallback = map[string]langID{ +var acceptFallback = map[string]language.Language{ "english": _en, "deutsch": _de, "italian": _it, diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index a108554a41..e22807719e 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -2,3327 +2,110 @@ package language -import "golang.org/x/text/internal/tag" - // CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "31" - -const numLanguages = 8654 - -const numScripts = 230 - -const numRegions = 356 - -type fromTo struct { - from uint16 - to uint16 -} - -const nonCanonicalUnd = 1199 -const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 249 - _da = 256 - _de = 268 - _el = 309 - _en = 312 - _es = 317 - _et = 319 - _fa = 327 - _fi = 336 - _fil = 338 - _fr = 349 - _gu = 418 - _he = 442 - _hi = 444 - _hr = 463 - _hu = 467 - _hy = 469 - _id = 479 - _is = 502 - _it = 503 - _ja = 510 - _ka = 526 - _kk = 576 - _km = 584 - _kn = 591 - _ko = 594 - _ky = 648 - _lo = 694 - _lt = 702 - _lv = 709 - _mk = 765 - _ml = 770 - _mn = 777 - _mo = 782 - _mr = 793 - _ms = 797 - _mul = 804 - _my = 815 - _nb = 837 - _ne = 847 - _nl = 869 - _no = 877 - _pa = 923 - _pl = 945 - _pt = 958 - _ro = 986 - _ru = 992 - _sh = 1029 - _si = 1034 - _sk = 1040 - _sl = 1044 - _sq = 1071 - _sr = 1072 - _sv = 1090 - _sw = 1091 - _ta = 1102 - _te = 1119 - _th = 1129 - _tl = 1144 - _tn = 1150 - _tr = 1160 - _uk = 1196 - _ur = 1202 - _uz = 1210 - _vi = 1217 - _zh = 1319 - _zu = 1324 - _jbo = 513 - _ami = 1647 - _bnn = 2354 - _hak = 436 - _tlh = 14464 - _lb = 659 - _nv = 897 - _pwn = 12052 - _tao = 14185 - _tay = 14195 - _tsu = 14659 - _nn = 872 - _sfb = 13626 - _vgt = 15698 - _sgg = 13657 - _cmn = 3004 - _nan = 833 - _hsn = 465 -) - -const langPrivateStart = 0x2f6f - -const langPrivateEnd = 0x3176 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5312 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cooscop\x00cps\x00crrecrh\x00crj\x00cr" + - "k\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad" + - "\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn" + - "\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00d" + - "je\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp" + - "\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00d" + - "yu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00elllema" + - "\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr\x00ett" + - "\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai\x00fan" + - "\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod" + - "\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00f" + - "ud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalega" + - "a\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm" + - "\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00g" + - "ez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp" + - "\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom" + - "\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw\x00gsw\x00guujg" + - "ub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf\x00gvr\x00gvs" + - "\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00haw\x00haz\x00h" + - "bb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hil\x00hla\x00hl" + - "u\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00hoj\x00" + - "hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian\x00iar\x00iba" + - "\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00ieleife\x00igbo" + - "igb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00ilo\x00imo\x00i" + - "nndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00iws\x00izh\x00i" + - "zi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo\x00ji\x00\x06jib" + - "\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac\x00kad\x00" + - "kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq\x00kbx\x00kby\x00kc" + - "g\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt\x00kea\x00ken\x00kez" + - "\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00kha\x00khb\x00khn\x00k" + - "hq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu\x00kiw\x00kjuakjd\x00kj" + - "g\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00klq\x00klt\x00klx\x00kmh" + - "mkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knanknf\x00knp\x00koorkoi\x00" + - "kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo\x00kpr\x00kpx\x00kqb\x00kq" + - "f\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00krl\x00krs\x00kru\x00ksasksb" + - "\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb\x00ktm\x00kto\x00kuurkub\x00k" + - "ud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00kus\x00kvomkvg\x00kvr\x00kvx" + - "\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm\x00kxp\x00kxw\x00kxz\x00ky" + - "irkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag\x00lah\x00laj\x00las\x00lbt" + - "zlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00led\x00lee\x00lem\x00lep\x00l" + - "eq\x00leu\x00lez\x00lguglgg\x00liimlia\x00lid\x00lif\x00lig\x00lih\x00li" + - "j\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln\x00lmn\x00lmo\x00lmp\x00lnin" + - "lns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor\x00los\x00loz\x00lrc\x00ltitl" + - "tg\x00luublua\x00luo\x00luy\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00ma" + - "f\x00mag\x00mai\x00mak\x00man\x00mas\x00maw\x00maz\x00mbh\x00mbo\x00mbq" + - "\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr\x00mcu\x00mda\x00mde\x00mdf" + - "\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee\x00mek\x00men\x00mer\x00met" + - "\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq\x00mglgmgh\x00mgl\x00mgo\x00m" + - "gp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00min\x00mis\x00miw\x00mkkdmki" + - "\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00mls\x00mmo\x00mmu\x00mmx\x00m" + - "nonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00moe\x00moh\x00mos\x00mox\x00mp" + - "p\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00mrj\x00mro\x00mssamtltmtc" + - "\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00mus\x00mva\x00mvn\x00mvy" + - "\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk\x00mym\x00myv\x00myw\x00m" + - "yx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw\x00mzz\x00naaunac\x00naf" + - "\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00nbobnca\x00nce\x00ncf\x00n" + - "ch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb\x00new\x00nex\x00nfr\x00ng" + - "donga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00nif\x00nii\x00nij\x00nin\x00" + - "niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nlldnmg\x00nmz\x00nnnonnf\x00n" + - "nh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00nop\x00nou\x00nqo\x00nrblnr" + - "b\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr\x00nui\x00nup\x00nus\x00nuv" + - "\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym\x00nyn\x00nzi\x00occiogc\x00" + - "ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00opm\x00orrioro\x00oru\x00osss" + - "osa\x00ota\x00otk\x00ozm\x00paanpag\x00pal\x00pam\x00pap\x00pau\x00pbi" + - "\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo\x00pex\x00pfl\x00phl\x00phn" + - "\x00pilipil\x00pip\x00pka\x00pko\x00plolpla\x00pms\x00png\x00pnn\x00pnt" + - "\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psuspss\x00ptorptp\x00puu\x00pwa" + - "\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rcf\x00rej\x00rel\x00res\x00r" + - "gn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu" + - "\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00rro\x00rtm\x00ruusrue\x00" + - "rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf\x00sah\x00saq\x00sas\x00sa" + - "t\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00scl\x00scn\x00sco\x00" + - "scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00ses\x00sgagsga\x00sgs" + - "\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu\x00siinsid\x00sig" + - "\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllvsld\x00sli\x00sll" + - "\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq\x00sms\x00snnasnc" + - "\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou\x00soy\x00spd\x00s" + - "pl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00ssswssd\x00ssg\x00ssy" + - "\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00sus\x00svweswwaswb" + - "\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00syr\x00szl\x00taamt" + - "aj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00tbo\x00tbw\x00tbz" + - "\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem\x00teo\x00tet\x00t" + - "fi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr\x00tiirtif\x00tig" + - "\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt\x00tlgltlf\x00tlx" + - "\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00toq\x00tpi\x00tpm" + - "\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00tsf\x00tsg\x00tsj" + - "\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt\x00tuh\x00tul\x00t" + - "um\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00txg\x00tyahtya\x00ty" + - "v\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb\x00und\x00unr\x00unx" + - "\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00uvl\x00uzzbvag\x00vai" + - "\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls\x00vmf\x00vmw\x00vool" + - "vot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal\x00wan\x00war\x00wbp" + - "\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib\x00wiu\x00wiv\x00wja" + - "\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolwob\x00wos\x00wrs\x00w" + - "sk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr\x00xes\x00xhhoxla" + - "\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00xog\x00xon\x00xpr" + - "\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao\x00yap\x00yas" + - "\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer\x00ygr\x00ygw" + - "\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb\x00yre\x00yrl" + - "\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00zbl\x00zdj\x00z" + - "ea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zza\x00\xff\xff" + - "\xff\xff" - -const langNoIndexOffset = 1327 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, - 0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, - 0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, - 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44, - // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0x8c, 0x58, 0xd5, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, - 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x027f, 0x0405, 0x01f9, 0x03e3, 0x013d, 0x0206, -} - -// langAliasMap maps langIDs to their suggested replacements. -// Size: 644 bytes, 161 elements -var langAliasMap = [161]fromTo{ - 0: {from: 0x82, to: 0x88}, - 1: {from: 0x185, to: 0x1ac}, - 2: {from: 0x1f1, to: 0x1df}, - 3: {from: 0x1f9, to: 0x1ba}, - 4: {from: 0x206, to: 0x510}, - 5: {from: 0x20d, to: 0x20c}, - 6: {from: 0x30e, to: 0x3da}, - 7: {from: 0x345, to: 0x36d}, - 8: {from: 0x405, to: 0x430}, - 9: {from: 0x478, to: 0x152}, - 10: {from: 0x48e, to: 0x44f}, - 11: {from: 0x4a0, to: 0x21}, - 12: {from: 0x53b, to: 0x541}, - 13: {from: 0x58c, to: 0x12c}, - 14: {from: 0x62d, to: 0x1eae}, - 15: {from: 0x64e, to: 0x42f}, - 16: {from: 0x65f, to: 0x42f}, - 17: {from: 0x6ea, to: 0x3a}, - 18: {from: 0x6f5, to: 0x1d5}, - 19: {from: 0x73b, to: 0x219e}, - 20: {from: 0x7b0, to: 0x56}, - 21: {from: 0x7b6, to: 0x2998}, - 22: {from: 0x7c2, to: 0x58}, - 23: {from: 0x7e3, to: 0x144}, - 24: {from: 0x809, to: 0x5a}, - 25: {from: 0x812, to: 0x8d}, - 26: {from: 0x87b, to: 0x80d}, - 27: {from: 0x8c0, to: 0xee0}, - 28: {from: 0x9ec, to: 0x32f}, - 29: {from: 0xa33, to: 0x2c3}, - 30: {from: 0xa3a, to: 0xbf}, - 31: {from: 0xabb, to: 0x331f}, - 32: {from: 0xb35, to: 0x527}, - 33: {from: 0xb72, to: 0x2657}, - 34: {from: 0xb7b, to: 0xbc0}, - 35: {from: 0xb98, to: 0x44c}, - 36: {from: 0xbb9, to: 0x4226}, - 37: {from: 0xbbc, to: 0x527}, - 38: {from: 0xbfb, to: 0x2da4}, - 39: {from: 0xc2b, to: 0x317e}, - 40: {from: 0xcb6, to: 0xf2}, - 41: {from: 0xd05, to: 0xf9}, - 42: {from: 0xdc5, to: 0x119}, - 43: {from: 0xdd4, to: 0x32b}, - 44: {from: 0xdf5, to: 0xdf8}, - 45: {from: 0xdfb, to: 0x52e}, - 46: {from: 0xedc, to: 0x2057}, - 47: {from: 0xeeb, to: 0x2e97}, - 48: {from: 0xf36, to: 0x365}, - 49: {from: 0x10cd, to: 0x13f}, - 50: {from: 0x1101, to: 0x2ce}, - 51: {from: 0x119d, to: 0x1ea}, - 52: {from: 0x1276, to: 0x21}, - 53: {from: 0x1421, to: 0x15d}, - 54: {from: 0x146d, to: 0x14d}, - 55: {from: 0x151c, to: 0xd98}, - 56: {from: 0x1520, to: 0x38e}, - 57: {from: 0x152f, to: 0x19d}, - 58: {from: 0x157d, to: 0x20e}, - 59: {from: 0x1580, to: 0x10c}, - 60: {from: 0x15a0, to: 0x3cac}, - 61: {from: 0x1667, to: 0x199}, - 62: {from: 0x16c5, to: 0x135}, - 63: {from: 0x16fd, to: 0x29f5}, - 64: {from: 0x1715, to: 0x192}, - 65: {from: 0x1724, to: 0xf3c}, - 66: {from: 0x1777, to: 0x1521}, - 67: {from: 0x1806, to: 0x17b3}, - 68: {from: 0x1813, to: 0x18f0}, - 69: {from: 0x1887, to: 0x434}, - 70: {from: 0x1976, to: 0x1cfe}, - 71: {from: 0x1a71, to: 0x2bad}, - 72: {from: 0x1a87, to: 0x1f6}, - 73: {from: 0x1b57, to: 0x1f8}, - 74: {from: 0x1b83, to: 0x1512}, - 75: {from: 0x2035, to: 0x37ae}, - 76: {from: 0x203a, to: 0x20da}, - 77: {from: 0x2057, to: 0x309}, - 78: {from: 0x20e0, to: 0x272}, - 79: {from: 0x20eb, to: 0x261}, - 80: {from: 0x20ef, to: 0x22b}, - 81: {from: 0x20f6, to: 0x254}, - 82: {from: 0x210c, to: 0x21e8}, - 83: {from: 0x2132, to: 0x27b}, - 84: {from: 0x2196, to: 0x120}, - 85: {from: 0x21cb, to: 0x155e}, - 86: {from: 0x21e3, to: 0x502}, - 87: {from: 0x21f1, to: 0x49d}, - 88: {from: 0x222a, to: 0x120}, - 89: {from: 0x2234, to: 0x120}, - 90: {from: 0x225f, to: 0x927}, - 91: {from: 0x2313, to: 0x3223}, - 92: {from: 0x237f, to: 0x3362}, - 93: {from: 0x246f, to: 0x2c5}, - 94: {from: 0x24e1, to: 0x2fd}, - 95: {from: 0x24ed, to: 0x2f8}, - 96: {from: 0x24f7, to: 0x31d}, - 97: {from: 0x254d, to: 0xb58}, - 98: {from: 0x25a6, to: 0xe2}, - 99: {from: 0x263b, to: 0x2ce}, - 100: {from: 0x26c6, to: 0x26b1}, - 101: {from: 0x26f6, to: 0x3c6}, - 102: {from: 0x2724, to: 0x3cac}, - 103: {from: 0x2762, to: 0x26b1}, - 104: {from: 0x2786, to: 0x4355}, - 105: {from: 0x28ec, to: 0x2834}, - 106: {from: 0x2911, to: 0x34f}, - 107: {from: 0x2983, to: 0x2da4}, - 108: {from: 0x2b17, to: 0x38b}, - 109: {from: 0x2bf9, to: 0x393}, - 110: {from: 0x2c3c, to: 0x3cac}, - 111: {from: 0x2cf9, to: 0x3bc}, - 112: {from: 0x2d10, to: 0x594}, - 113: {from: 0x2d44, to: 0x147}, - 114: {from: 0x2d45, to: 0x147}, - 115: {from: 0x2dfc, to: 0x2ef}, - 116: {from: 0x2e05, to: 0x19c9}, - 117: {from: 0x2e17, to: 0x2d92}, - 118: {from: 0x2e1e, to: 0x290}, - 119: {from: 0x2e51, to: 0x7d}, - 120: {from: 0x2e62, to: 0x227f}, - 121: {from: 0x2e9d, to: 0x2e98}, - 122: {from: 0x2eec, to: 0x2ed4}, - 123: {from: 0x3190, to: 0x3c2}, - 124: {from: 0x3363, to: 0x338b}, - 125: {from: 0x3427, to: 0x3da}, - 126: {from: 0x34eb, to: 0x18cd}, - 127: {from: 0x35e3, to: 0x410}, - 128: {from: 0x3655, to: 0x244}, - 129: {from: 0x3673, to: 0x3f2}, - 130: {from: 0x36fa, to: 0x443}, - 131: {from: 0x37bd, to: 0x120}, - 132: {from: 0x3813, to: 0x38ef}, - 133: {from: 0x3828, to: 0x2c98}, - 134: {from: 0x382c, to: 0xa9}, - 135: {from: 0x382f, to: 0x3225}, - 136: {from: 0x3869, to: 0x39a3}, - 137: {from: 0x388f, to: 0x3fbd}, - 138: {from: 0x38a2, to: 0x39d4}, - 139: {from: 0x38b1, to: 0x1fa1}, - 140: {from: 0x38b2, to: 0x2e97}, - 141: {from: 0x3959, to: 0x47c}, - 142: {from: 0x3b4b, to: 0xd8e}, - 143: {from: 0x3b75, to: 0x136}, - 144: {from: 0x3c96, to: 0x4ba}, - 145: {from: 0x3fba, to: 0xff}, - 146: {from: 0x4205, to: 0xa8e}, - 147: {from: 0x42bb, to: 0x570}, - 148: {from: 0x42f6, to: 0x3f5d}, - 149: {from: 0x4375, to: 0x258}, - 150: {from: 0x43c8, to: 0x36c8}, - 151: {from: 0x43ca, to: 0x10e}, - 152: {from: 0x44ac, to: 0x331f}, - 153: {from: 0x44e0, to: 0x510}, - 154: {from: 0x45c7, to: 0x2406}, - 155: {from: 0x45da, to: 0x26d9}, - 156: {from: 0x460d, to: 0x48ab}, - 157: {from: 0x46ab, to: 0x469d}, - 158: {from: 0x473b, to: 0x4742}, - 159: {from: 0x4913, to: 0x31d}, - 160: {from: 0x49a4, to: 0x521}, -} - -// Size: 161 bytes, 161 elements -var langAliasTypes = [161]langAliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, - 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, - 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, - // Entry 40 - 7F - 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1, - 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2, - 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, - 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2, - // Entry 80 - BF - 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, - 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1, - 1, -} +const CLDRVersion = "32" const ( - _Latn = 82 - _Hani = 50 - _Hans = 52 - _Hant = 53 - _Qaaa = 131 - _Qaai = 139 - _Qabx = 180 - _Zinh = 224 - _Zyyy = 229 - _Zzzz = 230 + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 ) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 928 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" + - "EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" + - "HatrHebrHiraHluwHmngHrktHungIndsItalJamoJavaJpanJurcKaliKanaKharKhmrKhoj" + - "KitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepcLimbLinaLinbLisuLoma" + - "LyciLydiMahjMandManiMarcMayaMendMercMeroMlymModiMongMoonMrooMteiMultMymr" + - "NarbNbatNewaNkgbNkooNshuOgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlp" + - "PhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + - "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + - "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + - "QabxRjngRoroRunrSamrSaraSarbSaurSgnwShawShrdSiddSindSinhSoraSundSyloSyrc" + - "SyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirh" + - "UgarVaiiVispWaraWoleXpeoXsuxYiiiZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff" + - "\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1327 bytes, 1327 elements -var suppressScript = [1327]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - // Entry 100 - 13F - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd4, - 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x2d, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, 0x52, - // Entry 140 - 17F - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x05, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x37, 0x00, 0x20, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x52, 0x00, 0x52, 0x52, 0x00, 0x08, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, - 0x00, 0x37, 0x00, 0x00, 0x00, 0x00, 0x41, 0x00, - // Entry 200 - 23F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4a, - 0x00, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - // Entry 2C0 - 2FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, - // Entry 300 - 33F - 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x6b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52, 0x00, - // Entry 3C0 - 3FF - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, - // Entry 480 - 4BF - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - // Entry 4C0 - 4FF - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, -} - const ( _001 = 1 - _419 = 30 - _BR = 64 - _CA = 72 - _ES = 109 - _GB = 122 - _MD = 187 - _PT = 237 - _UK = 305 - _US = 308 - _ZZ = 356 - _XA = 322 - _XC = 324 - _XK = 332 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 ) -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 31 - -// regionTypes defines the status of a region for various standards. -// Size: 357 bytes, 357 elements -var regionTypes = [357]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04, - 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104, - 0x0120, 0x015e, 0x00db, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]fromTo{ - 0: {from: 0x43, to: 0xc3}, - 1: {from: 0x57, to: 0xa6}, - 2: {from: 0x5e, to: 0x5f}, - 3: {from: 0x65, to: 0x3a}, - 4: {from: 0x78, to: 0x77}, - 5: {from: 0x92, to: 0x36}, - 6: {from: 0xa2, to: 0x132}, - 7: {from: 0xc0, to: 0x132}, - 8: {from: 0xd6, to: 0x13e}, - 9: {from: 0xdb, to: 0x2a}, - 10: {from: 0xee, to: 0x132}, - 11: {from: 0xf1, to: 0xe1}, - 12: {from: 0xfb, to: 0x6f}, - 13: {from: 0x102, to: 0x163}, - 14: {from: 0x129, to: 0x125}, - 15: {from: 0x131, to: 0x7a}, - 16: {from: 0x139, to: 0x13d}, - 17: {from: 0x140, to: 0x132}, - 18: {from: 0x15c, to: 0x15d}, - 19: {from: 0x162, to: 0x4a}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 714 bytes, 357 elements -var m49 = [357]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 419, 958, - 0, 20, 784, 4, 28, 660, 8, 51, - 530, 24, 10, 32, 16, 40, 36, 533, - 248, 31, 70, 52, 50, 56, 854, 100, - 48, 108, 204, 652, 60, 96, 68, 535, - // Entry 40 - 7F - 76, 44, 64, 104, 74, 72, 112, 84, - 124, 166, 180, 140, 178, 756, 384, 184, - 152, 120, 156, 170, 0, 188, 891, 296, - 192, 132, 531, 162, 196, 203, 278, 276, - 0, 262, 208, 212, 214, 204, 12, 0, - 218, 233, 818, 732, 232, 724, 231, 967, - 0, 246, 242, 238, 583, 234, 0, 250, - 249, 266, 826, 308, 268, 254, 831, 288, - // Entry 80 - BF - 292, 304, 270, 324, 312, 226, 300, 239, - 320, 316, 624, 328, 344, 334, 340, 191, - 332, 348, 854, 0, 360, 372, 376, 833, - 356, 86, 368, 364, 352, 380, 832, 388, - 400, 392, 581, 404, 417, 116, 296, 174, - 659, 408, 410, 414, 136, 398, 418, 422, - 662, 438, 144, 430, 426, 440, 442, 428, - 434, 504, 492, 498, 499, 663, 450, 584, - // Entry C0 - FF - 581, 807, 466, 104, 496, 446, 580, 474, - 478, 500, 470, 480, 462, 454, 484, 458, - 508, 516, 540, 562, 574, 566, 548, 558, - 528, 578, 524, 10, 520, 536, 570, 554, - 512, 591, 0, 604, 258, 598, 608, 586, - 616, 666, 612, 630, 275, 620, 581, 585, - 600, 591, 634, 959, 960, 961, 962, 963, - 964, 965, 966, 967, 968, 969, 970, 971, - // Entry 100 - 13F - 972, 638, 716, 642, 688, 643, 646, 682, - 90, 690, 729, 752, 702, 654, 705, 744, - 703, 694, 674, 686, 706, 740, 728, 678, - 810, 222, 534, 760, 748, 0, 796, 148, - 260, 768, 764, 762, 772, 626, 795, 788, - 776, 626, 792, 780, 798, 158, 834, 804, - 800, 826, 581, 0, 840, 858, 860, 336, - 670, 704, 862, 92, 850, 704, 548, 876, - // Entry 140 - 17F - 581, 882, 973, 974, 975, 976, 977, 978, - 979, 980, 981, 982, 983, 984, 985, 986, - 987, 988, 989, 990, 991, 992, 993, 994, - 995, 996, 997, 998, 720, 887, 175, 891, - 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 107, 142, 180, 219, 258, 290, - 332, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 664 bytes, 332 elements -var fromM49 = [332]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0823, 0x0a04, 0x1026, 0x1205, 0x142a, - 0x1606, 0x1866, 0x1a07, 0x1c08, 0x1e09, 0x202c, 0x220a, 0x240b, - 0x260c, 0x2821, 0x2a0d, 0x3029, 0x3824, 0x3a0e, 0x3c0f, 0x3e31, - 0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038, - 0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c, - 0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847, - 0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046, - 0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d, - 0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c, - 0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a, - 0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e, - 0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030, - 0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c, - 0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6, - 0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b, - // Entry 80 - BF - 0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898, - 0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f, - 0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4, - 0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1, - 0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2, - 0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb, - 0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da, - 0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2, - // Entry C0 - FF - 0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9, - 0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5, - 0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525, - 0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d, - 0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17, - 0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d, - 0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a, - 0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b, - // Entry 100 - 13F - 0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927, - 0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518, - 0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c, - 0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d, - 0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7, - 0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff, - 0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748, - 0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750, - // Entry 140 - 17F - 0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758, - 0xc959, 0xcb5a, 0xcd5b, 0xcf64, -} - -// Size: 1463 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x45, - "1996": 0x4, - "abl1943": 0x5, - "alalc97": 0x47, - "aluku": 0x6, - "ao1990": 0x7, - "arevela": 0x8, - "arevmda": 0x9, - "baku1926": 0xa, - "balanka": 0xb, - "barla": 0xc, - "basiceng": 0xd, - "bauddha": 0xe, - "biscayan": 0xf, - "biske": 0x40, - "bohoric": 0x10, - "boont": 0x11, - "colb1945": 0x12, - "cornu": 0x13, - "dajnko": 0x14, - "ekavsk": 0x15, - "emodeng": 0x16, - "fonipa": 0x48, - "fonnapa": 0x49, - "fonupa": 0x4a, - "fonxsamp": 0x4b, - "hepburn": 0x17, - "heploc": 0x46, - "hognorsk": 0x18, - "ijekavsk": 0x19, - "itihasa": 0x1a, - "jauer": 0x1b, - "jyutping": 0x1c, - "kkcor": 0x1d, - "kociewie": 0x1e, - "kscor": 0x1f, - "laukika": 0x20, - "lipaw": 0x41, - "luna1918": 0x21, - "metelko": 0x22, - "monoton": 0x23, - "ndyuka": 0x24, - "nedis": 0x25, - "newfound": 0x26, - "njiva": 0x42, - "nulik": 0x27, - "osojs": 0x43, - "oxendict": 0x28, - "pamaka": 0x29, - "petr1708": 0x2a, - "pinyin": 0x2b, - "polyton": 0x2c, - "puter": 0x2d, - "rigik": 0x2e, - "rozaj": 0x2f, - "rumgr": 0x30, - "scotland": 0x31, - "scouse": 0x32, - "simple": 0x4c, - "solba": 0x44, - "sotav": 0x33, - "surmiran": 0x34, - "sursilv": 0x35, - "sutsilv": 0x36, - "tarask": 0x37, - "uccor": 0x38, - "ucrcor": 0x39, - "ulster": 0x3a, - "unifon": 0x3b, - "vaidika": 0x3c, - "valencia": 0x3d, - "vallader": 0x3e, - "wadegile": 0x3f, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 71 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 32 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 928 bytes, 232 elements -var likelyScript = [232]likelyLangRegion{ - 1: {lang: 0x14d, region: 0x83}, - 3: {lang: 0x2a0, region: 0x105}, - 4: {lang: 0x1f, region: 0x98}, - 5: {lang: 0x3a, region: 0x6a}, - 7: {lang: 0x3b, region: 0x9b}, - 8: {lang: 0x1d5, region: 0x27}, - 9: {lang: 0x13, region: 0x9b}, - 10: {lang: 0x5b, region: 0x94}, - 11: {lang: 0x60, region: 0x51}, - 12: {lang: 0xb9, region: 0xb3}, - 13: {lang: 0x63, region: 0x94}, - 14: {lang: 0xa5, region: 0x34}, - 15: {lang: 0x3e7, region: 0x98}, - 17: {lang: 0x527, region: 0x12d}, - 18: {lang: 0x3af, region: 0x98}, - 19: {lang: 0x15d, region: 0x77}, - 20: {lang: 0xc2, region: 0x94}, - 21: {lang: 0x9d, region: 0xe6}, - 22: {lang: 0xdb, region: 0x34}, - 23: {lang: 0xf2, region: 0x48}, - 24: {lang: 0x4ee, region: 0x12a}, - 25: {lang: 0xe7, region: 0x13d}, - 26: {lang: 0xe5, region: 0x134}, - 28: {lang: 0xf0, region: 0x6a}, - 29: {lang: 0x19e, region: 0x5c}, - 30: {lang: 0x3e0, region: 0x105}, - 32: {lang: 0x1bc, region: 0x98}, - 34: {lang: 0x15d, region: 0x77}, - 37: {lang: 0x132, region: 0x6a}, - 38: {lang: 0x42f, region: 0x26}, - 39: {lang: 0x27, region: 0x6e}, - 41: {lang: 0x20e, region: 0x7c}, - 42: {lang: 0xfd, region: 0x37}, - 43: {lang: 0x19c, region: 0x12f}, - 44: {lang: 0x3e7, region: 0x98}, - 45: {lang: 0x135, region: 0x86}, - 46: {lang: 0x1a2, region: 0x98}, - 47: {lang: 0x39b, region: 0x98}, - 48: {lang: 0x527, region: 0x12d}, - 49: {lang: 0x252, region: 0xaa}, - 50: {lang: 0x527, region: 0x52}, - 51: {lang: 0x1c9, region: 0xe6}, - 52: {lang: 0x527, region: 0x52}, - 53: {lang: 0x527, region: 0x12d}, - 54: {lang: 0x2fb, region: 0x9a}, - 55: {lang: 0x1ba, region: 0x96}, - 56: {lang: 0x1fe, region: 0xa1}, - 57: {lang: 0x1c3, region: 0x12a}, - 58: {lang: 0x1c8, region: 0xae}, - 60: {lang: 0x1d3, region: 0x91}, - 62: {lang: 0x141, region: 0x9d}, - 63: {lang: 0x252, region: 0xaa}, - 64: {lang: 0x20c, region: 0x94}, - 65: {lang: 0x1fe, region: 0xa1}, - 67: {lang: 0x134, region: 0xc3}, - 68: {lang: 0x1fe, region: 0xa1}, - 69: {lang: 0x3b9, region: 0xe7}, - 70: {lang: 0x248, region: 0xa5}, - 71: {lang: 0x3f8, region: 0x98}, - 74: {lang: 0x24f, region: 0x98}, - 75: {lang: 0x252, region: 0xaa}, - 77: {lang: 0x88, region: 0x98}, - 78: {lang: 0x36e, region: 0x122}, - 79: {lang: 0x2b6, region: 0xae}, - 84: {lang: 0x29d, region: 0x98}, - 85: {lang: 0x2a6, region: 0x98}, - 86: {lang: 0x28d, region: 0x86}, - 87: {lang: 0x19e, region: 0x86}, - 88: {lang: 0x2aa, region: 0x52}, - 90: {lang: 0x4f2, region: 0x12a}, - 91: {lang: 0x4f3, region: 0x12a}, - 92: {lang: 0x1bc, region: 0x98}, - 93: {lang: 0x335, region: 0x9b}, - 94: {lang: 0x4f5, region: 0x52}, - 95: {lang: 0xa9, region: 0x52}, - 97: {lang: 0x2e6, region: 0x111}, - 98: {lang: 0x4f6, region: 0x10a}, - 99: {lang: 0x4f6, region: 0x10a}, - 100: {lang: 0x302, region: 0x98}, - 101: {lang: 0x319, region: 0x98}, - 102: {lang: 0x309, region: 0x52}, - 104: {lang: 0x31c, region: 0x34}, - 105: {lang: 0x30c, region: 0x98}, - 106: {lang: 0x412, region: 0xe7}, - 107: {lang: 0x32f, region: 0xc3}, - 108: {lang: 0x4f7, region: 0x107}, - 109: {lang: 0x3b, region: 0xa0}, - 110: {lang: 0x351, region: 0xda}, - 112: {lang: 0x2ce, region: 0x83}, - 114: {lang: 0x401, region: 0x95}, - 115: {lang: 0x3ec, region: 0x98}, - 116: {lang: 0x399, region: 0xc4}, - 117: {lang: 0x393, region: 0x98}, - 118: {lang: 0x397, region: 0x134}, - 119: {lang: 0x427, region: 0x114}, - 120: {lang: 0x3b, region: 0x11b}, - 121: {lang: 0xfc, region: 0xc3}, - 122: {lang: 0x27b, region: 0x105}, - 123: {lang: 0x2c7, region: 0x52}, - 124: {lang: 0x39d, region: 0x9b}, - 125: {lang: 0x39d, region: 0x52}, - 127: {lang: 0x3ab, region: 0xaf}, - 129: {lang: 0x1c4, region: 0x52}, - 130: {lang: 0x4fb, region: 0x9b}, - 181: {lang: 0x3c9, region: 0x94}, - 183: {lang: 0x370, region: 0x10b}, - 184: {lang: 0x41e, region: 0x96}, - 186: {lang: 0x4fd, region: 0x15d}, - 187: {lang: 0x3ee, region: 0x98}, - 188: {lang: 0x45, region: 0x134}, - 189: {lang: 0x138, region: 0x7a}, - 190: {lang: 0x3e7, region: 0x98}, - 191: {lang: 0x3e7, region: 0x98}, - 192: {lang: 0x3f8, region: 0x98}, - 193: {lang: 0x40a, region: 0xb2}, - 194: {lang: 0x431, region: 0x98}, - 195: {lang: 0x43c, region: 0x94}, - 196: {lang: 0x44b, region: 0x34}, - 197: {lang: 0x44c, region: 0x9a}, - 201: {lang: 0x458, region: 0xe6}, - 202: {lang: 0x119, region: 0x98}, - 203: {lang: 0x45c, region: 0x52}, - 204: {lang: 0x230, region: 0x52}, - 205: {lang: 0x44e, region: 0x98}, - 206: {lang: 0x4a3, region: 0x52}, - 207: {lang: 0x9f, region: 0x13d}, - 208: {lang: 0x45f, region: 0x98}, - 210: {lang: 0x526, region: 0xb9}, - 211: {lang: 0x152, region: 0xe6}, - 212: {lang: 0x127, region: 0xcc}, - 213: {lang: 0x469, region: 0x122}, - 214: {lang: 0xa9, region: 0x52}, - 215: {lang: 0x2cc, region: 0x98}, - 216: {lang: 0x4ab, region: 0x11b}, - 217: {lang: 0x4bc, region: 0xb3}, - 219: {lang: 0x1cc, region: 0x98}, - 221: {lang: 0x3a7, region: 0x9b}, - 222: {lang: 0x22, region: 0x9a}, - 223: {lang: 0x1e8, region: 0x52}, -} - -type likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 5308 bytes, 1327 elements -var likelyLang = [1327]likelyScriptRegion{ - 0: {region: 0x134, script: 0x52, flags: 0x0}, - 1: {region: 0x6e, script: 0x52, flags: 0x0}, - 2: {region: 0x164, script: 0x52, flags: 0x0}, - 3: {region: 0x164, script: 0x52, flags: 0x0}, - 4: {region: 0x164, script: 0x52, flags: 0x0}, - 5: {region: 0x7c, script: 0x1e, flags: 0x0}, - 6: {region: 0x164, script: 0x52, flags: 0x0}, - 7: {region: 0x164, script: 0x1e, flags: 0x0}, - 8: {region: 0x7f, script: 0x52, flags: 0x0}, - 9: {region: 0x164, script: 0x52, flags: 0x0}, - 10: {region: 0x164, script: 0x52, flags: 0x0}, - 11: {region: 0x164, script: 0x52, flags: 0x0}, - 12: {region: 0x94, script: 0x52, flags: 0x0}, - 13: {region: 0x130, script: 0x52, flags: 0x0}, - 14: {region: 0x7f, script: 0x52, flags: 0x0}, - 15: {region: 0x164, script: 0x52, flags: 0x0}, - 16: {region: 0x164, script: 0x52, flags: 0x0}, - 17: {region: 0x105, script: 0x1e, flags: 0x0}, - 18: {region: 0x164, script: 0x52, flags: 0x0}, - 19: {region: 0x9b, script: 0x9, flags: 0x0}, - 20: {region: 0x127, script: 0x5, flags: 0x0}, - 21: {region: 0x164, script: 0x52, flags: 0x0}, - 22: {region: 0x160, script: 0x52, flags: 0x0}, - 23: {region: 0x164, script: 0x52, flags: 0x0}, - 24: {region: 0x164, script: 0x52, flags: 0x0}, - 25: {region: 0x164, script: 0x52, flags: 0x0}, - 26: {region: 0x164, script: 0x52, flags: 0x0}, - 27: {region: 0x164, script: 0x52, flags: 0x0}, - 28: {region: 0x51, script: 0x52, flags: 0x0}, - 29: {region: 0x164, script: 0x52, flags: 0x0}, - 30: {region: 0x164, script: 0x52, flags: 0x0}, - 31: {region: 0x98, script: 0x4, flags: 0x0}, - 32: {region: 0x164, script: 0x52, flags: 0x0}, - 33: {region: 0x7f, script: 0x52, flags: 0x0}, - 34: {region: 0x9a, script: 0xde, flags: 0x0}, - 35: {region: 0x164, script: 0x52, flags: 0x0}, - 36: {region: 0x164, script: 0x52, flags: 0x0}, - 37: {region: 0x14c, script: 0x52, flags: 0x0}, - 38: {region: 0x105, script: 0x1e, flags: 0x0}, - 39: {region: 0x6e, script: 0x27, flags: 0x0}, - 40: {region: 0x164, script: 0x52, flags: 0x0}, - 41: {region: 0x164, script: 0x52, flags: 0x0}, - 42: {region: 0xd5, script: 0x52, flags: 0x0}, - 43: {region: 0x164, script: 0x52, flags: 0x0}, - 45: {region: 0x164, script: 0x52, flags: 0x0}, - 46: {region: 0x164, script: 0x52, flags: 0x0}, - 47: {region: 0x164, script: 0x52, flags: 0x0}, - 48: {region: 0x164, script: 0x52, flags: 0x0}, - 49: {region: 0x164, script: 0x52, flags: 0x0}, - 50: {region: 0x164, script: 0x52, flags: 0x0}, - 51: {region: 0x94, script: 0x52, flags: 0x0}, - 52: {region: 0x164, script: 0x5, flags: 0x0}, - 53: {region: 0x121, script: 0x5, flags: 0x0}, - 54: {region: 0x164, script: 0x52, flags: 0x0}, - 55: {region: 0x164, script: 0x52, flags: 0x0}, - 56: {region: 0x164, script: 0x52, flags: 0x0}, - 57: {region: 0x164, script: 0x52, flags: 0x0}, - 58: {region: 0x6a, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x164, script: 0x52, flags: 0x0}, - 61: {region: 0x50, script: 0x52, flags: 0x0}, - 62: {region: 0x3e, script: 0x52, flags: 0x0}, - 63: {region: 0x66, script: 0x5, flags: 0x0}, - 65: {region: 0xb9, script: 0x5, flags: 0x0}, - 66: {region: 0x6a, script: 0x5, flags: 0x0}, - 67: {region: 0x98, script: 0xe, flags: 0x0}, - 68: {region: 0x12e, script: 0x52, flags: 0x0}, - 69: {region: 0x134, script: 0xbc, flags: 0x0}, - 70: {region: 0x164, script: 0x52, flags: 0x0}, - 71: {region: 0x164, script: 0x52, flags: 0x0}, - 72: {region: 0x6d, script: 0x52, flags: 0x0}, - 73: {region: 0x164, script: 0x52, flags: 0x0}, - 74: {region: 0x164, script: 0x52, flags: 0x0}, - 75: {region: 0x48, script: 0x52, flags: 0x0}, - 76: {region: 0x164, script: 0x52, flags: 0x0}, - 77: {region: 0x105, script: 0x1e, flags: 0x0}, - 78: {region: 0x164, script: 0x5, flags: 0x0}, - 79: {region: 0x164, script: 0x52, flags: 0x0}, - 80: {region: 0x164, script: 0x52, flags: 0x0}, - 81: {region: 0x164, script: 0x52, flags: 0x0}, - 82: {region: 0x98, script: 0x20, flags: 0x0}, - 83: {region: 0x164, script: 0x52, flags: 0x0}, - 84: {region: 0x164, script: 0x52, flags: 0x0}, - 85: {region: 0x164, script: 0x52, flags: 0x0}, - 86: {region: 0x3e, script: 0x52, flags: 0x0}, - 87: {region: 0x164, script: 0x52, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x105, script: 0x1e, flags: 0x0}, - 90: {region: 0xe7, script: 0x5, flags: 0x0}, - 91: {region: 0x94, script: 0x52, flags: 0x0}, - 92: {region: 0xda, script: 0x20, flags: 0x0}, - 93: {region: 0x2d, script: 0x52, flags: 0x0}, - 94: {region: 0x51, script: 0x52, flags: 0x0}, - 95: {region: 0x164, script: 0x52, flags: 0x0}, - 96: {region: 0x51, script: 0xb, flags: 0x0}, - 97: {region: 0x164, script: 0x52, flags: 0x0}, - 98: {region: 0x164, script: 0x52, flags: 0x0}, - 99: {region: 0x94, script: 0x52, flags: 0x0}, - 100: {region: 0x164, script: 0x52, flags: 0x0}, - 101: {region: 0x51, script: 0x52, flags: 0x0}, - 102: {region: 0x164, script: 0x52, flags: 0x0}, - 103: {region: 0x164, script: 0x52, flags: 0x0}, - 104: {region: 0x164, script: 0x52, flags: 0x0}, - 105: {region: 0x164, script: 0x52, flags: 0x0}, - 106: {region: 0x4e, script: 0x52, flags: 0x0}, - 107: {region: 0x164, script: 0x52, flags: 0x0}, - 108: {region: 0x164, script: 0x52, flags: 0x0}, - 109: {region: 0x164, script: 0x52, flags: 0x0}, - 110: {region: 0x164, script: 0x27, flags: 0x0}, - 111: {region: 0x164, script: 0x52, flags: 0x0}, - 112: {region: 0x164, script: 0x52, flags: 0x0}, - 113: {region: 0x46, script: 0x1e, flags: 0x0}, - 114: {region: 0x164, script: 0x52, flags: 0x0}, - 115: {region: 0x164, script: 0x52, flags: 0x0}, - 116: {region: 0x10a, script: 0x5, flags: 0x0}, - 117: {region: 0x161, script: 0x52, flags: 0x0}, - 118: {region: 0x164, script: 0x52, flags: 0x0}, - 119: {region: 0x94, script: 0x52, flags: 0x0}, - 120: {region: 0x164, script: 0x52, flags: 0x0}, - 121: {region: 0x12e, script: 0x52, flags: 0x0}, - 122: {region: 0x51, script: 0x52, flags: 0x0}, - 123: {region: 0x98, script: 0xcd, flags: 0x0}, - 124: {region: 0xe7, script: 0x5, flags: 0x0}, - 125: {region: 0x98, script: 0x20, flags: 0x0}, - 126: {region: 0x37, script: 0x1e, flags: 0x0}, - 127: {region: 0x98, script: 0x20, flags: 0x0}, - 128: {region: 0xe7, script: 0x5, flags: 0x0}, - 129: {region: 0x12a, script: 0x2d, flags: 0x0}, - 131: {region: 0x98, script: 0x20, flags: 0x0}, - 132: {region: 0x164, script: 0x52, flags: 0x0}, - 133: {region: 0x98, script: 0x20, flags: 0x0}, - 134: {region: 0xe6, script: 0x52, flags: 0x0}, - 135: {region: 0x164, script: 0x52, flags: 0x0}, - 136: {region: 0x98, script: 0x20, flags: 0x0}, - 137: {region: 0x164, script: 0x52, flags: 0x0}, - 138: {region: 0x13e, script: 0x52, flags: 0x0}, - 139: {region: 0x164, script: 0x52, flags: 0x0}, - 140: {region: 0x164, script: 0x52, flags: 0x0}, - 141: {region: 0xe6, script: 0x52, flags: 0x0}, - 142: {region: 0x164, script: 0x52, flags: 0x0}, - 143: {region: 0xd5, script: 0x52, flags: 0x0}, - 144: {region: 0x164, script: 0x52, flags: 0x0}, - 145: {region: 0x164, script: 0x52, flags: 0x0}, - 146: {region: 0x164, script: 0x52, flags: 0x0}, - 147: {region: 0x164, script: 0x27, flags: 0x0}, - 148: {region: 0x98, script: 0x20, flags: 0x0}, - 149: {region: 0x94, script: 0x52, flags: 0x0}, - 150: {region: 0x164, script: 0x52, flags: 0x0}, - 151: {region: 0x164, script: 0x52, flags: 0x0}, - 152: {region: 0x113, script: 0x52, flags: 0x0}, - 153: {region: 0x164, script: 0x52, flags: 0x0}, - 154: {region: 0x164, script: 0x52, flags: 0x0}, - 155: {region: 0x51, script: 0x52, flags: 0x0}, - 156: {region: 0x164, script: 0x52, flags: 0x0}, - 157: {region: 0xe6, script: 0x52, flags: 0x0}, - 158: {region: 0x164, script: 0x52, flags: 0x0}, - 159: {region: 0x13d, script: 0xcf, flags: 0x0}, - 160: {region: 0xc2, script: 0x52, flags: 0x0}, - 161: {region: 0x164, script: 0x52, flags: 0x0}, - 162: {region: 0x164, script: 0x52, flags: 0x0}, - 163: {region: 0xc2, script: 0x52, flags: 0x0}, - 164: {region: 0x164, script: 0x52, flags: 0x0}, - 165: {region: 0x34, script: 0xe, flags: 0x0}, - 166: {region: 0x164, script: 0x52, flags: 0x0}, - 167: {region: 0x164, script: 0x52, flags: 0x0}, - 168: {region: 0x164, script: 0x52, flags: 0x0}, - 169: {region: 0x52, script: 0xd6, flags: 0x0}, - 170: {region: 0x164, script: 0x52, flags: 0x0}, - 171: {region: 0x164, script: 0x52, flags: 0x0}, - 172: {region: 0x164, script: 0x52, flags: 0x0}, - 173: {region: 0x98, script: 0xe, flags: 0x0}, - 174: {region: 0x164, script: 0x52, flags: 0x0}, - 175: {region: 0x9b, script: 0x5, flags: 0x0}, - 176: {region: 0x164, script: 0x52, flags: 0x0}, - 177: {region: 0x4e, script: 0x52, flags: 0x0}, - 178: {region: 0x77, script: 0x52, flags: 0x0}, - 179: {region: 0x98, script: 0x20, flags: 0x0}, - 180: {region: 0xe7, script: 0x5, flags: 0x0}, - 181: {region: 0x98, script: 0x20, flags: 0x0}, - 182: {region: 0x164, script: 0x52, flags: 0x0}, - 183: {region: 0x32, script: 0x52, flags: 0x0}, - 184: {region: 0x164, script: 0x52, flags: 0x0}, - 185: {region: 0xb3, script: 0xc, flags: 0x0}, - 186: {region: 0x51, script: 0x52, flags: 0x0}, - 187: {region: 0x164, script: 0x27, flags: 0x0}, - 188: {region: 0xe6, script: 0x52, flags: 0x0}, - 189: {region: 0x164, script: 0x52, flags: 0x0}, - 190: {region: 0xe7, script: 0x20, flags: 0x0}, - 191: {region: 0x105, script: 0x1e, flags: 0x0}, - 192: {region: 0x15e, script: 0x52, flags: 0x0}, - 193: {region: 0x164, script: 0x52, flags: 0x0}, - 194: {region: 0x94, script: 0x52, flags: 0x0}, - 195: {region: 0x164, script: 0x52, flags: 0x0}, - 196: {region: 0x51, script: 0x52, flags: 0x0}, - 197: {region: 0x164, script: 0x52, flags: 0x0}, - 198: {region: 0x164, script: 0x52, flags: 0x0}, - 199: {region: 0x164, script: 0x52, flags: 0x0}, - 200: {region: 0x85, script: 0x52, flags: 0x0}, - 201: {region: 0x164, script: 0x52, flags: 0x0}, - 202: {region: 0x164, script: 0x52, flags: 0x0}, - 203: {region: 0x164, script: 0x52, flags: 0x0}, - 204: {region: 0x164, script: 0x52, flags: 0x0}, - 205: {region: 0x6c, script: 0x27, flags: 0x0}, - 206: {region: 0x164, script: 0x52, flags: 0x0}, - 207: {region: 0x164, script: 0x52, flags: 0x0}, - 208: {region: 0x51, script: 0x52, flags: 0x0}, - 209: {region: 0x164, script: 0x52, flags: 0x0}, - 210: {region: 0x164, script: 0x52, flags: 0x0}, - 211: {region: 0xc2, script: 0x52, flags: 0x0}, - 212: {region: 0x164, script: 0x52, flags: 0x0}, - 213: {region: 0x164, script: 0x52, flags: 0x0}, - 214: {region: 0x164, script: 0x52, flags: 0x0}, - 215: {region: 0x6d, script: 0x52, flags: 0x0}, - 216: {region: 0x164, script: 0x52, flags: 0x0}, - 217: {region: 0x164, script: 0x52, flags: 0x0}, - 218: {region: 0xd5, script: 0x52, flags: 0x0}, - 219: {region: 0x34, script: 0x16, flags: 0x0}, - 220: {region: 0x105, script: 0x1e, flags: 0x0}, - 221: {region: 0xe6, script: 0x52, flags: 0x0}, - 222: {region: 0x164, script: 0x52, flags: 0x0}, - 223: {region: 0x130, script: 0x52, flags: 0x0}, - 224: {region: 0x89, script: 0x52, flags: 0x0}, - 225: {region: 0x74, script: 0x52, flags: 0x0}, - 226: {region: 0x105, script: 0x1e, flags: 0x0}, - 227: {region: 0x134, script: 0x52, flags: 0x0}, - 228: {region: 0x48, script: 0x52, flags: 0x0}, - 229: {region: 0x134, script: 0x1a, flags: 0x0}, - 230: {region: 0xa5, script: 0x5, flags: 0x0}, - 231: {region: 0x13d, script: 0x19, flags: 0x0}, - 232: {region: 0x164, script: 0x52, flags: 0x0}, - 233: {region: 0x9a, script: 0x5, flags: 0x0}, - 234: {region: 0x164, script: 0x52, flags: 0x0}, - 235: {region: 0x164, script: 0x52, flags: 0x0}, - 236: {region: 0x164, script: 0x52, flags: 0x0}, - 237: {region: 0x164, script: 0x52, flags: 0x0}, - 238: {region: 0x164, script: 0x52, flags: 0x0}, - 239: {region: 0x77, script: 0x52, flags: 0x0}, - 240: {region: 0x6a, script: 0x1c, flags: 0x0}, - 241: {region: 0xe6, script: 0x52, flags: 0x0}, - 242: {region: 0x48, script: 0x17, flags: 0x0}, - 243: {region: 0x12f, script: 0x1e, flags: 0x0}, - 244: {region: 0x48, script: 0x17, flags: 0x0}, - 245: {region: 0x48, script: 0x17, flags: 0x0}, - 246: {region: 0x48, script: 0x17, flags: 0x0}, - 247: {region: 0x48, script: 0x17, flags: 0x0}, - 248: {region: 0x109, script: 0x52, flags: 0x0}, - 249: {region: 0x5d, script: 0x52, flags: 0x0}, - 250: {region: 0xe8, script: 0x52, flags: 0x0}, - 251: {region: 0x48, script: 0x17, flags: 0x0}, - 252: {region: 0xc3, script: 0x79, flags: 0x0}, - 253: {region: 0x8, script: 0x2, flags: 0x1}, - 254: {region: 0x105, script: 0x1e, flags: 0x0}, - 255: {region: 0x7a, script: 0x52, flags: 0x0}, - 256: {region: 0x62, script: 0x52, flags: 0x0}, - 257: {region: 0x164, script: 0x52, flags: 0x0}, - 258: {region: 0x164, script: 0x52, flags: 0x0}, - 259: {region: 0x164, script: 0x52, flags: 0x0}, - 260: {region: 0x164, script: 0x52, flags: 0x0}, - 261: {region: 0x134, script: 0x52, flags: 0x0}, - 262: {region: 0x105, script: 0x1e, flags: 0x0}, - 263: {region: 0xa3, script: 0x52, flags: 0x0}, - 264: {region: 0x164, script: 0x52, flags: 0x0}, - 265: {region: 0x164, script: 0x52, flags: 0x0}, - 266: {region: 0x98, script: 0x5, flags: 0x0}, - 267: {region: 0x164, script: 0x52, flags: 0x0}, - 268: {region: 0x5f, script: 0x52, flags: 0x0}, - 269: {region: 0x164, script: 0x52, flags: 0x0}, - 270: {region: 0x48, script: 0x52, flags: 0x0}, - 271: {region: 0x164, script: 0x52, flags: 0x0}, - 272: {region: 0x164, script: 0x52, flags: 0x0}, - 273: {region: 0x164, script: 0x52, flags: 0x0}, - 274: {region: 0x164, script: 0x5, flags: 0x0}, - 275: {region: 0x48, script: 0x52, flags: 0x0}, - 276: {region: 0x164, script: 0x52, flags: 0x0}, - 277: {region: 0x164, script: 0x52, flags: 0x0}, - 278: {region: 0xd3, script: 0x52, flags: 0x0}, - 279: {region: 0x4e, script: 0x52, flags: 0x0}, - 280: {region: 0x164, script: 0x52, flags: 0x0}, - 281: {region: 0x98, script: 0x5, flags: 0x0}, - 282: {region: 0x164, script: 0x52, flags: 0x0}, - 283: {region: 0x164, script: 0x52, flags: 0x0}, - 284: {region: 0x164, script: 0x52, flags: 0x0}, - 285: {region: 0x164, script: 0x27, flags: 0x0}, - 286: {region: 0x5f, script: 0x52, flags: 0x0}, - 287: {region: 0xc2, script: 0x52, flags: 0x0}, - 288: {region: 0xcf, script: 0x52, flags: 0x0}, - 289: {region: 0x164, script: 0x52, flags: 0x0}, - 290: {region: 0xda, script: 0x20, flags: 0x0}, - 291: {region: 0x51, script: 0x52, flags: 0x0}, - 292: {region: 0x164, script: 0x52, flags: 0x0}, - 293: {region: 0x164, script: 0x52, flags: 0x0}, - 294: {region: 0x164, script: 0x52, flags: 0x0}, - 295: {region: 0xcc, script: 0xd4, flags: 0x0}, - 296: {region: 0x164, script: 0x52, flags: 0x0}, - 297: {region: 0x164, script: 0x52, flags: 0x0}, - 298: {region: 0x113, script: 0x52, flags: 0x0}, - 299: {region: 0x36, script: 0x52, flags: 0x0}, - 300: {region: 0x42, script: 0xd6, flags: 0x0}, - 301: {region: 0x164, script: 0x52, flags: 0x0}, - 302: {region: 0xa3, script: 0x52, flags: 0x0}, - 303: {region: 0x7f, script: 0x52, flags: 0x0}, - 304: {region: 0xd5, script: 0x52, flags: 0x0}, - 305: {region: 0x9d, script: 0x52, flags: 0x0}, - 306: {region: 0x6a, script: 0x25, flags: 0x0}, - 307: {region: 0x164, script: 0x52, flags: 0x0}, - 308: {region: 0xc3, script: 0x43, flags: 0x0}, - 309: {region: 0x86, script: 0x2d, flags: 0x0}, - 310: {region: 0x164, script: 0x52, flags: 0x0}, - 311: {region: 0x164, script: 0x52, flags: 0x0}, - 312: {region: 0xa, script: 0x2, flags: 0x1}, - 313: {region: 0x164, script: 0x52, flags: 0x0}, - 314: {region: 0x164, script: 0x52, flags: 0x0}, - 315: {region: 0x1, script: 0x52, flags: 0x0}, - 316: {region: 0x164, script: 0x52, flags: 0x0}, - 317: {region: 0x6d, script: 0x52, flags: 0x0}, - 318: {region: 0x134, script: 0x52, flags: 0x0}, - 319: {region: 0x69, script: 0x52, flags: 0x0}, - 320: {region: 0x164, script: 0x52, flags: 0x0}, - 321: {region: 0x9d, script: 0x3e, flags: 0x0}, - 322: {region: 0x164, script: 0x52, flags: 0x0}, - 323: {region: 0x164, script: 0x52, flags: 0x0}, - 324: {region: 0x6d, script: 0x52, flags: 0x0}, - 325: {region: 0x51, script: 0x52, flags: 0x0}, - 326: {region: 0x6d, script: 0x52, flags: 0x0}, - 327: {region: 0x9b, script: 0x5, flags: 0x0}, - 328: {region: 0x164, script: 0x52, flags: 0x0}, - 329: {region: 0x164, script: 0x52, flags: 0x0}, - 330: {region: 0x164, script: 0x52, flags: 0x0}, - 331: {region: 0x164, script: 0x52, flags: 0x0}, - 332: {region: 0x85, script: 0x52, flags: 0x0}, - 333: {region: 0xc, script: 0x2, flags: 0x1}, - 334: {region: 0x164, script: 0x52, flags: 0x0}, - 335: {region: 0xc2, script: 0x52, flags: 0x0}, - 336: {region: 0x71, script: 0x52, flags: 0x0}, - 337: {region: 0x10a, script: 0x5, flags: 0x0}, - 338: {region: 0xe6, script: 0x52, flags: 0x0}, - 339: {region: 0x10b, script: 0x52, flags: 0x0}, - 340: {region: 0x72, script: 0x52, flags: 0x0}, - 341: {region: 0x164, script: 0x52, flags: 0x0}, - 342: {region: 0x164, script: 0x52, flags: 0x0}, - 343: {region: 0x75, script: 0x52, flags: 0x0}, - 344: {region: 0x164, script: 0x52, flags: 0x0}, - 345: {region: 0x3a, script: 0x52, flags: 0x0}, - 346: {region: 0x164, script: 0x52, flags: 0x0}, - 347: {region: 0x164, script: 0x52, flags: 0x0}, - 348: {region: 0x164, script: 0x52, flags: 0x0}, - 349: {region: 0x77, script: 0x52, flags: 0x0}, - 350: {region: 0x134, script: 0x52, flags: 0x0}, - 351: {region: 0x77, script: 0x52, flags: 0x0}, - 352: {region: 0x5f, script: 0x52, flags: 0x0}, - 353: {region: 0x5f, script: 0x52, flags: 0x0}, - 354: {region: 0x51, script: 0x5, flags: 0x0}, - 355: {region: 0x13f, script: 0x52, flags: 0x0}, - 356: {region: 0x164, script: 0x52, flags: 0x0}, - 357: {region: 0x83, script: 0x52, flags: 0x0}, - 358: {region: 0x164, script: 0x52, flags: 0x0}, - 359: {region: 0xd3, script: 0x52, flags: 0x0}, - 360: {region: 0x9d, script: 0x52, flags: 0x0}, - 361: {region: 0xd5, script: 0x52, flags: 0x0}, - 362: {region: 0x164, script: 0x52, flags: 0x0}, - 363: {region: 0x10a, script: 0x52, flags: 0x0}, - 364: {region: 0xd8, script: 0x52, flags: 0x0}, - 365: {region: 0x95, script: 0x52, flags: 0x0}, - 366: {region: 0x7f, script: 0x52, flags: 0x0}, - 367: {region: 0x164, script: 0x52, flags: 0x0}, - 368: {region: 0xbb, script: 0x52, flags: 0x0}, - 369: {region: 0x164, script: 0x52, flags: 0x0}, - 370: {region: 0x164, script: 0x52, flags: 0x0}, - 371: {region: 0x164, script: 0x52, flags: 0x0}, - 372: {region: 0x52, script: 0x34, flags: 0x0}, - 373: {region: 0x164, script: 0x52, flags: 0x0}, - 374: {region: 0x94, script: 0x52, flags: 0x0}, - 375: {region: 0x164, script: 0x52, flags: 0x0}, - 376: {region: 0x98, script: 0x20, flags: 0x0}, - 377: {region: 0x164, script: 0x52, flags: 0x0}, - 378: {region: 0x9b, script: 0x5, flags: 0x0}, - 379: {region: 0x7d, script: 0x52, flags: 0x0}, - 380: {region: 0x7a, script: 0x52, flags: 0x0}, - 381: {region: 0x164, script: 0x52, flags: 0x0}, - 382: {region: 0x164, script: 0x52, flags: 0x0}, - 383: {region: 0x164, script: 0x52, flags: 0x0}, - 384: {region: 0x164, script: 0x52, flags: 0x0}, - 385: {region: 0x164, script: 0x52, flags: 0x0}, - 386: {region: 0x164, script: 0x52, flags: 0x0}, - 387: {region: 0x6e, script: 0x27, flags: 0x0}, - 388: {region: 0x164, script: 0x52, flags: 0x0}, - 389: {region: 0xda, script: 0x20, flags: 0x0}, - 390: {region: 0x164, script: 0x52, flags: 0x0}, - 391: {region: 0xa6, script: 0x52, flags: 0x0}, - 392: {region: 0x164, script: 0x52, flags: 0x0}, - 393: {region: 0xe7, script: 0x5, flags: 0x0}, - 394: {region: 0x164, script: 0x52, flags: 0x0}, - 395: {region: 0xe7, script: 0x5, flags: 0x0}, - 396: {region: 0x164, script: 0x52, flags: 0x0}, - 397: {region: 0x164, script: 0x52, flags: 0x0}, - 398: {region: 0x6d, script: 0x52, flags: 0x0}, - 399: {region: 0x9b, script: 0x5, flags: 0x0}, - 400: {region: 0x164, script: 0x52, flags: 0x0}, - 401: {region: 0x164, script: 0x27, flags: 0x0}, - 402: {region: 0xf0, script: 0x52, flags: 0x0}, - 403: {region: 0x164, script: 0x52, flags: 0x0}, - 404: {region: 0x164, script: 0x52, flags: 0x0}, - 405: {region: 0x164, script: 0x52, flags: 0x0}, - 406: {region: 0x164, script: 0x27, flags: 0x0}, - 407: {region: 0x164, script: 0x52, flags: 0x0}, - 408: {region: 0x98, script: 0x20, flags: 0x0}, - 409: {region: 0x98, script: 0xd0, flags: 0x0}, - 410: {region: 0x94, script: 0x52, flags: 0x0}, - 411: {region: 0xd8, script: 0x52, flags: 0x0}, - 412: {region: 0x12f, script: 0x2b, flags: 0x0}, - 413: {region: 0x164, script: 0x52, flags: 0x0}, - 414: {region: 0xe, script: 0x2, flags: 0x1}, - 415: {region: 0x98, script: 0xe, flags: 0x0}, - 416: {region: 0x164, script: 0x52, flags: 0x0}, - 417: {region: 0x4d, script: 0x52, flags: 0x0}, - 418: {region: 0x98, script: 0x2e, flags: 0x0}, - 419: {region: 0x40, script: 0x52, flags: 0x0}, - 420: {region: 0x53, script: 0x52, flags: 0x0}, - 421: {region: 0x164, script: 0x52, flags: 0x0}, - 422: {region: 0x7f, script: 0x52, flags: 0x0}, - 423: {region: 0x164, script: 0x52, flags: 0x0}, - 424: {region: 0x164, script: 0x52, flags: 0x0}, - 425: {region: 0xa3, script: 0x52, flags: 0x0}, - 426: {region: 0x97, script: 0x52, flags: 0x0}, - 427: {region: 0x164, script: 0x52, flags: 0x0}, - 428: {region: 0xda, script: 0x20, flags: 0x0}, - 429: {region: 0x164, script: 0x52, flags: 0x0}, - 430: {region: 0x164, script: 0x5, flags: 0x0}, - 431: {region: 0x48, script: 0x52, flags: 0x0}, - 432: {region: 0x164, script: 0x5, flags: 0x0}, - 433: {region: 0x164, script: 0x52, flags: 0x0}, - 434: {region: 0x10, script: 0x3, flags: 0x1}, - 435: {region: 0x164, script: 0x52, flags: 0x0}, - 436: {region: 0x52, script: 0x34, flags: 0x0}, - 437: {region: 0x164, script: 0x52, flags: 0x0}, - 438: {region: 0x134, script: 0x52, flags: 0x0}, - 439: {region: 0x23, script: 0x5, flags: 0x0}, - 440: {region: 0x164, script: 0x52, flags: 0x0}, - 441: {region: 0x164, script: 0x27, flags: 0x0}, - 442: {region: 0x96, script: 0x37, flags: 0x0}, - 443: {region: 0x164, script: 0x52, flags: 0x0}, - 444: {region: 0x98, script: 0x20, flags: 0x0}, - 445: {region: 0x164, script: 0x52, flags: 0x0}, - 446: {region: 0x72, script: 0x52, flags: 0x0}, - 447: {region: 0x164, script: 0x52, flags: 0x0}, - 448: {region: 0x164, script: 0x52, flags: 0x0}, - 449: {region: 0xe6, script: 0x52, flags: 0x0}, - 450: {region: 0x164, script: 0x52, flags: 0x0}, - 451: {region: 0x12a, script: 0x39, flags: 0x0}, - 452: {region: 0x52, script: 0x81, flags: 0x0}, - 453: {region: 0x164, script: 0x52, flags: 0x0}, - 454: {region: 0xe7, script: 0x5, flags: 0x0}, - 455: {region: 0x98, script: 0x20, flags: 0x0}, - 456: {region: 0xae, script: 0x3a, flags: 0x0}, - 457: {region: 0xe6, script: 0x52, flags: 0x0}, - 458: {region: 0xe7, script: 0x5, flags: 0x0}, - 459: {region: 0xe5, script: 0x52, flags: 0x0}, - 460: {region: 0x98, script: 0x20, flags: 0x0}, - 461: {region: 0x98, script: 0x20, flags: 0x0}, - 462: {region: 0x164, script: 0x52, flags: 0x0}, - 463: {region: 0x8f, script: 0x52, flags: 0x0}, - 464: {region: 0x5f, script: 0x52, flags: 0x0}, - 465: {region: 0x52, script: 0x34, flags: 0x0}, - 466: {region: 0x90, script: 0x52, flags: 0x0}, - 467: {region: 0x91, script: 0x52, flags: 0x0}, - 468: {region: 0x164, script: 0x52, flags: 0x0}, - 469: {region: 0x27, script: 0x8, flags: 0x0}, - 470: {region: 0xd1, script: 0x52, flags: 0x0}, - 471: {region: 0x77, script: 0x52, flags: 0x0}, - 472: {region: 0x164, script: 0x52, flags: 0x0}, - 473: {region: 0x164, script: 0x52, flags: 0x0}, - 474: {region: 0xcf, script: 0x52, flags: 0x0}, - 475: {region: 0xd5, script: 0x52, flags: 0x0}, - 476: {region: 0x164, script: 0x52, flags: 0x0}, - 477: {region: 0x164, script: 0x52, flags: 0x0}, - 478: {region: 0x164, script: 0x52, flags: 0x0}, - 479: {region: 0x94, script: 0x52, flags: 0x0}, - 480: {region: 0x164, script: 0x52, flags: 0x0}, - 481: {region: 0x164, script: 0x52, flags: 0x0}, - 482: {region: 0x164, script: 0x52, flags: 0x0}, - 484: {region: 0x121, script: 0x52, flags: 0x0}, - 485: {region: 0xd5, script: 0x52, flags: 0x0}, - 486: {region: 0x164, script: 0x52, flags: 0x0}, - 487: {region: 0x164, script: 0x52, flags: 0x0}, - 488: {region: 0x52, script: 0xdf, flags: 0x0}, - 489: {region: 0x164, script: 0x52, flags: 0x0}, - 490: {region: 0x134, script: 0x52, flags: 0x0}, - 491: {region: 0x164, script: 0x52, flags: 0x0}, - 492: {region: 0x48, script: 0x52, flags: 0x0}, - 493: {region: 0x164, script: 0x52, flags: 0x0}, - 494: {region: 0x164, script: 0x52, flags: 0x0}, - 495: {region: 0xe6, script: 0x52, flags: 0x0}, - 496: {region: 0x164, script: 0x52, flags: 0x0}, - 497: {region: 0x94, script: 0x52, flags: 0x0}, - 498: {region: 0x105, script: 0x1e, flags: 0x0}, - 500: {region: 0x164, script: 0x52, flags: 0x0}, - 501: {region: 0x164, script: 0x52, flags: 0x0}, - 502: {region: 0x9c, script: 0x52, flags: 0x0}, - 503: {region: 0x9d, script: 0x52, flags: 0x0}, - 504: {region: 0x48, script: 0x17, flags: 0x0}, - 505: {region: 0x96, script: 0x37, flags: 0x0}, - 506: {region: 0x164, script: 0x52, flags: 0x0}, - 507: {region: 0x164, script: 0x52, flags: 0x0}, - 508: {region: 0x105, script: 0x52, flags: 0x0}, - 509: {region: 0x164, script: 0x52, flags: 0x0}, - 510: {region: 0xa1, script: 0x41, flags: 0x0}, - 511: {region: 0x164, script: 0x52, flags: 0x0}, - 512: {region: 0x9f, script: 0x52, flags: 0x0}, - 514: {region: 0x164, script: 0x52, flags: 0x0}, - 515: {region: 0x164, script: 0x52, flags: 0x0}, - 516: {region: 0x164, script: 0x52, flags: 0x0}, - 517: {region: 0x51, script: 0x52, flags: 0x0}, - 518: {region: 0x12f, script: 0x37, flags: 0x0}, - 519: {region: 0x164, script: 0x52, flags: 0x0}, - 520: {region: 0x12e, script: 0x52, flags: 0x0}, - 521: {region: 0xda, script: 0x20, flags: 0x0}, - 522: {region: 0x164, script: 0x52, flags: 0x0}, - 523: {region: 0x62, script: 0x52, flags: 0x0}, - 524: {region: 0x94, script: 0x52, flags: 0x0}, - 525: {region: 0x94, script: 0x52, flags: 0x0}, - 526: {region: 0x7c, script: 0x29, flags: 0x0}, - 527: {region: 0x136, script: 0x1e, flags: 0x0}, - 528: {region: 0x66, script: 0x52, flags: 0x0}, - 529: {region: 0xc3, script: 0x52, flags: 0x0}, - 530: {region: 0x164, script: 0x52, flags: 0x0}, - 531: {region: 0x164, script: 0x52, flags: 0x0}, - 532: {region: 0xd5, script: 0x52, flags: 0x0}, - 533: {region: 0xa3, script: 0x52, flags: 0x0}, - 534: {region: 0xc2, script: 0x52, flags: 0x0}, - 535: {region: 0x105, script: 0x1e, flags: 0x0}, - 536: {region: 0x164, script: 0x52, flags: 0x0}, - 537: {region: 0x164, script: 0x52, flags: 0x0}, - 538: {region: 0x164, script: 0x52, flags: 0x0}, - 539: {region: 0x164, script: 0x52, flags: 0x0}, - 540: {region: 0xd3, script: 0x5, flags: 0x0}, - 541: {region: 0xd5, script: 0x52, flags: 0x0}, - 542: {region: 0x163, script: 0x52, flags: 0x0}, - 543: {region: 0x164, script: 0x52, flags: 0x0}, - 544: {region: 0x164, script: 0x52, flags: 0x0}, - 545: {region: 0x12e, script: 0x52, flags: 0x0}, - 546: {region: 0x121, script: 0x5, flags: 0x0}, - 547: {region: 0x164, script: 0x52, flags: 0x0}, - 548: {region: 0x122, script: 0xd5, flags: 0x0}, - 549: {region: 0x59, script: 0x52, flags: 0x0}, - 550: {region: 0x51, script: 0x52, flags: 0x0}, - 551: {region: 0x164, script: 0x52, flags: 0x0}, - 552: {region: 0x4e, script: 0x52, flags: 0x0}, - 553: {region: 0x98, script: 0x20, flags: 0x0}, - 554: {region: 0x98, script: 0x20, flags: 0x0}, - 555: {region: 0x4a, script: 0x52, flags: 0x0}, - 556: {region: 0x94, script: 0x52, flags: 0x0}, - 557: {region: 0x164, script: 0x52, flags: 0x0}, - 558: {region: 0x40, script: 0x52, flags: 0x0}, - 559: {region: 0x98, script: 0x52, flags: 0x0}, - 560: {region: 0x52, script: 0xcc, flags: 0x0}, - 561: {region: 0x98, script: 0x20, flags: 0x0}, - 562: {region: 0xc2, script: 0x52, flags: 0x0}, - 563: {region: 0x164, script: 0x52, flags: 0x0}, - 564: {region: 0x98, script: 0x6b, flags: 0x0}, - 565: {region: 0xe7, script: 0x5, flags: 0x0}, - 566: {region: 0x164, script: 0x52, flags: 0x0}, - 567: {region: 0xa3, script: 0x52, flags: 0x0}, - 568: {region: 0x164, script: 0x52, flags: 0x0}, - 569: {region: 0x12a, script: 0x52, flags: 0x0}, - 570: {region: 0x164, script: 0x52, flags: 0x0}, - 571: {region: 0xd1, script: 0x52, flags: 0x0}, - 572: {region: 0x164, script: 0x52, flags: 0x0}, - 573: {region: 0xae, script: 0x4f, flags: 0x0}, - 574: {region: 0x164, script: 0x52, flags: 0x0}, - 575: {region: 0x164, script: 0x52, flags: 0x0}, - 576: {region: 0x13, script: 0x6, flags: 0x1}, - 577: {region: 0x164, script: 0x52, flags: 0x0}, - 578: {region: 0x51, script: 0x52, flags: 0x0}, - 579: {region: 0x81, script: 0x52, flags: 0x0}, - 580: {region: 0xa3, script: 0x52, flags: 0x0}, - 581: {region: 0x164, script: 0x52, flags: 0x0}, - 582: {region: 0x164, script: 0x52, flags: 0x0}, - 583: {region: 0x164, script: 0x52, flags: 0x0}, - 584: {region: 0xa5, script: 0x46, flags: 0x0}, - 585: {region: 0x29, script: 0x52, flags: 0x0}, - 586: {region: 0x164, script: 0x52, flags: 0x0}, - 587: {region: 0x164, script: 0x52, flags: 0x0}, - 588: {region: 0x164, script: 0x52, flags: 0x0}, - 589: {region: 0x164, script: 0x52, flags: 0x0}, - 590: {region: 0x164, script: 0x52, flags: 0x0}, - 591: {region: 0x98, script: 0x4a, flags: 0x0}, - 592: {region: 0x113, script: 0x52, flags: 0x0}, - 593: {region: 0x164, script: 0x52, flags: 0x0}, - 594: {region: 0xaa, script: 0x4b, flags: 0x0}, - 595: {region: 0x105, script: 0x1e, flags: 0x0}, - 596: {region: 0x98, script: 0x20, flags: 0x0}, - 597: {region: 0x164, script: 0x52, flags: 0x0}, - 598: {region: 0x74, script: 0x52, flags: 0x0}, - 599: {region: 0x164, script: 0x52, flags: 0x0}, - 600: {region: 0xb3, script: 0x52, flags: 0x0}, - 601: {region: 0x164, script: 0x52, flags: 0x0}, - 602: {region: 0x164, script: 0x52, flags: 0x0}, - 603: {region: 0x164, script: 0x52, flags: 0x0}, - 604: {region: 0x164, script: 0x52, flags: 0x0}, - 605: {region: 0x164, script: 0x52, flags: 0x0}, - 606: {region: 0x164, script: 0x52, flags: 0x0}, - 607: {region: 0x164, script: 0x52, flags: 0x0}, - 608: {region: 0x164, script: 0x27, flags: 0x0}, - 610: {region: 0x105, script: 0x1e, flags: 0x0}, - 611: {region: 0x111, script: 0x52, flags: 0x0}, - 612: {region: 0xe6, script: 0x52, flags: 0x0}, - 613: {region: 0x105, script: 0x52, flags: 0x0}, - 614: {region: 0x164, script: 0x52, flags: 0x0}, - 615: {region: 0x98, script: 0x20, flags: 0x0}, - 616: {region: 0x98, script: 0x5, flags: 0x0}, - 617: {region: 0x12e, script: 0x52, flags: 0x0}, - 618: {region: 0x164, script: 0x52, flags: 0x0}, - 619: {region: 0x51, script: 0x52, flags: 0x0}, - 620: {region: 0x5f, script: 0x52, flags: 0x0}, - 621: {region: 0x164, script: 0x52, flags: 0x0}, - 622: {region: 0x164, script: 0x52, flags: 0x0}, - 623: {region: 0x164, script: 0x27, flags: 0x0}, - 624: {region: 0x164, script: 0x52, flags: 0x0}, - 625: {region: 0x164, script: 0x52, flags: 0x0}, - 626: {region: 0x19, script: 0x3, flags: 0x1}, - 627: {region: 0x164, script: 0x52, flags: 0x0}, - 628: {region: 0x164, script: 0x52, flags: 0x0}, - 629: {region: 0x164, script: 0x52, flags: 0x0}, - 630: {region: 0x164, script: 0x52, flags: 0x0}, - 631: {region: 0x105, script: 0x1e, flags: 0x0}, - 632: {region: 0x164, script: 0x52, flags: 0x0}, - 633: {region: 0x164, script: 0x52, flags: 0x0}, - 634: {region: 0x164, script: 0x52, flags: 0x0}, - 635: {region: 0x105, script: 0x1e, flags: 0x0}, - 636: {region: 0x164, script: 0x52, flags: 0x0}, - 637: {region: 0x94, script: 0x52, flags: 0x0}, - 638: {region: 0xe7, script: 0x5, flags: 0x0}, - 639: {region: 0x7a, script: 0x52, flags: 0x0}, - 640: {region: 0x164, script: 0x52, flags: 0x0}, - 641: {region: 0x164, script: 0x52, flags: 0x0}, - 642: {region: 0x164, script: 0x52, flags: 0x0}, - 643: {region: 0x164, script: 0x27, flags: 0x0}, - 644: {region: 0x122, script: 0xd5, flags: 0x0}, - 645: {region: 0xe7, script: 0x5, flags: 0x0}, - 646: {region: 0x164, script: 0x52, flags: 0x0}, - 647: {region: 0x164, script: 0x52, flags: 0x0}, - 648: {region: 0x1c, script: 0x5, flags: 0x1}, - 649: {region: 0x164, script: 0x52, flags: 0x0}, - 650: {region: 0x164, script: 0x52, flags: 0x0}, - 651: {region: 0x164, script: 0x52, flags: 0x0}, - 652: {region: 0x137, script: 0x52, flags: 0x0}, - 653: {region: 0x86, script: 0x56, flags: 0x0}, - 654: {region: 0x96, script: 0x37, flags: 0x0}, - 655: {region: 0x12e, script: 0x52, flags: 0x0}, - 656: {region: 0xe7, script: 0x5, flags: 0x0}, - 657: {region: 0x130, script: 0x52, flags: 0x0}, - 658: {region: 0x164, script: 0x52, flags: 0x0}, - 659: {region: 0xb6, script: 0x52, flags: 0x0}, - 660: {region: 0x105, script: 0x1e, flags: 0x0}, - 661: {region: 0x164, script: 0x52, flags: 0x0}, - 662: {region: 0x94, script: 0x52, flags: 0x0}, - 663: {region: 0x164, script: 0x52, flags: 0x0}, - 664: {region: 0x52, script: 0xd5, flags: 0x0}, - 665: {region: 0x164, script: 0x52, flags: 0x0}, - 666: {region: 0x164, script: 0x52, flags: 0x0}, - 667: {region: 0x164, script: 0x52, flags: 0x0}, - 668: {region: 0x164, script: 0x52, flags: 0x0}, - 669: {region: 0x98, script: 0x54, flags: 0x0}, - 670: {region: 0x164, script: 0x52, flags: 0x0}, - 671: {region: 0x164, script: 0x52, flags: 0x0}, - 672: {region: 0x105, script: 0x1e, flags: 0x0}, - 673: {region: 0x130, script: 0x52, flags: 0x0}, - 674: {region: 0x164, script: 0x52, flags: 0x0}, - 675: {region: 0xd8, script: 0x52, flags: 0x0}, - 676: {region: 0x164, script: 0x52, flags: 0x0}, - 677: {region: 0x164, script: 0x52, flags: 0x0}, - 678: {region: 0x21, script: 0x2, flags: 0x1}, - 679: {region: 0x164, script: 0x52, flags: 0x0}, - 680: {region: 0x164, script: 0x52, flags: 0x0}, - 681: {region: 0x9d, script: 0x52, flags: 0x0}, - 682: {region: 0x52, script: 0x58, flags: 0x0}, - 683: {region: 0x94, script: 0x52, flags: 0x0}, - 684: {region: 0x9b, script: 0x5, flags: 0x0}, - 685: {region: 0x134, script: 0x52, flags: 0x0}, - 686: {region: 0x164, script: 0x52, flags: 0x0}, - 687: {region: 0x164, script: 0x52, flags: 0x0}, - 688: {region: 0x98, script: 0xd0, flags: 0x0}, - 689: {region: 0x9d, script: 0x52, flags: 0x0}, - 690: {region: 0x164, script: 0x52, flags: 0x0}, - 691: {region: 0x4a, script: 0x52, flags: 0x0}, - 692: {region: 0x164, script: 0x52, flags: 0x0}, - 693: {region: 0x164, script: 0x52, flags: 0x0}, - 694: {region: 0xae, script: 0x4f, flags: 0x0}, - 695: {region: 0x164, script: 0x52, flags: 0x0}, - 696: {region: 0x164, script: 0x52, flags: 0x0}, - 697: {region: 0x4a, script: 0x52, flags: 0x0}, - 698: {region: 0x164, script: 0x52, flags: 0x0}, - 699: {region: 0x164, script: 0x52, flags: 0x0}, - 700: {region: 0x161, script: 0x52, flags: 0x0}, - 701: {region: 0x9b, script: 0x5, flags: 0x0}, - 702: {region: 0xb5, script: 0x52, flags: 0x0}, - 703: {region: 0xb7, script: 0x52, flags: 0x0}, - 704: {region: 0x4a, script: 0x52, flags: 0x0}, - 705: {region: 0x4a, script: 0x52, flags: 0x0}, - 706: {region: 0xa3, script: 0x52, flags: 0x0}, - 707: {region: 0xa3, script: 0x52, flags: 0x0}, - 708: {region: 0x9b, script: 0x5, flags: 0x0}, - 709: {region: 0xb7, script: 0x52, flags: 0x0}, - 710: {region: 0x122, script: 0xd5, flags: 0x0}, - 711: {region: 0x52, script: 0x34, flags: 0x0}, - 712: {region: 0x12a, script: 0x52, flags: 0x0}, - 713: {region: 0x94, script: 0x52, flags: 0x0}, - 714: {region: 0x51, script: 0x52, flags: 0x0}, - 715: {region: 0x98, script: 0x20, flags: 0x0}, - 716: {region: 0x98, script: 0x20, flags: 0x0}, - 717: {region: 0x94, script: 0x52, flags: 0x0}, - 718: {region: 0x23, script: 0x3, flags: 0x1}, - 719: {region: 0xa3, script: 0x52, flags: 0x0}, - 720: {region: 0x164, script: 0x52, flags: 0x0}, - 721: {region: 0xce, script: 0x52, flags: 0x0}, - 722: {region: 0x164, script: 0x52, flags: 0x0}, - 723: {region: 0x164, script: 0x52, flags: 0x0}, - 724: {region: 0x164, script: 0x52, flags: 0x0}, - 725: {region: 0x164, script: 0x52, flags: 0x0}, - 726: {region: 0x164, script: 0x52, flags: 0x0}, - 727: {region: 0x164, script: 0x52, flags: 0x0}, - 728: {region: 0x164, script: 0x52, flags: 0x0}, - 729: {region: 0x164, script: 0x52, flags: 0x0}, - 730: {region: 0x164, script: 0x52, flags: 0x0}, - 731: {region: 0x164, script: 0x52, flags: 0x0}, - 732: {region: 0x164, script: 0x52, flags: 0x0}, - 733: {region: 0x164, script: 0x5, flags: 0x0}, - 734: {region: 0x105, script: 0x1e, flags: 0x0}, - 735: {region: 0xe6, script: 0x52, flags: 0x0}, - 736: {region: 0x164, script: 0x52, flags: 0x0}, - 737: {region: 0x94, script: 0x52, flags: 0x0}, - 738: {region: 0x164, script: 0x27, flags: 0x0}, - 739: {region: 0x164, script: 0x52, flags: 0x0}, - 740: {region: 0x164, script: 0x52, flags: 0x0}, - 741: {region: 0x164, script: 0x52, flags: 0x0}, - 742: {region: 0x111, script: 0x52, flags: 0x0}, - 743: {region: 0xa3, script: 0x52, flags: 0x0}, - 744: {region: 0x164, script: 0x52, flags: 0x0}, - 745: {region: 0x164, script: 0x52, flags: 0x0}, - 746: {region: 0x122, script: 0x5, flags: 0x0}, - 747: {region: 0xcb, script: 0x52, flags: 0x0}, - 748: {region: 0x164, script: 0x52, flags: 0x0}, - 749: {region: 0x164, script: 0x52, flags: 0x0}, - 750: {region: 0x164, script: 0x52, flags: 0x0}, - 751: {region: 0xbe, script: 0x52, flags: 0x0}, - 752: {region: 0xd0, script: 0x52, flags: 0x0}, - 753: {region: 0x164, script: 0x52, flags: 0x0}, - 754: {region: 0x51, script: 0x52, flags: 0x0}, - 755: {region: 0xda, script: 0x20, flags: 0x0}, - 756: {region: 0x12e, script: 0x52, flags: 0x0}, - 757: {region: 0xbf, script: 0x52, flags: 0x0}, - 758: {region: 0x164, script: 0x52, flags: 0x0}, - 759: {region: 0x164, script: 0x52, flags: 0x0}, - 760: {region: 0xdf, script: 0x52, flags: 0x0}, - 761: {region: 0x164, script: 0x52, flags: 0x0}, - 762: {region: 0x94, script: 0x52, flags: 0x0}, - 763: {region: 0x9a, script: 0x36, flags: 0x0}, - 764: {region: 0x164, script: 0x52, flags: 0x0}, - 765: {region: 0xc1, script: 0x1e, flags: 0x0}, - 766: {region: 0x164, script: 0x5, flags: 0x0}, - 767: {region: 0x164, script: 0x52, flags: 0x0}, - 768: {region: 0x164, script: 0x52, flags: 0x0}, - 769: {region: 0x164, script: 0x52, flags: 0x0}, - 770: {region: 0x98, script: 0x64, flags: 0x0}, - 771: {region: 0x164, script: 0x52, flags: 0x0}, - 772: {region: 0x164, script: 0x52, flags: 0x0}, - 773: {region: 0x10a, script: 0x52, flags: 0x0}, - 774: {region: 0x164, script: 0x52, flags: 0x0}, - 775: {region: 0x164, script: 0x52, flags: 0x0}, - 776: {region: 0x164, script: 0x52, flags: 0x0}, - 777: {region: 0x26, script: 0x3, flags: 0x1}, - 778: {region: 0x164, script: 0x52, flags: 0x0}, - 779: {region: 0x164, script: 0x52, flags: 0x0}, - 780: {region: 0x98, script: 0xe, flags: 0x0}, - 781: {region: 0xc3, script: 0x6b, flags: 0x0}, - 783: {region: 0x164, script: 0x52, flags: 0x0}, - 784: {region: 0x48, script: 0x52, flags: 0x0}, - 785: {region: 0x48, script: 0x52, flags: 0x0}, - 786: {region: 0x36, script: 0x52, flags: 0x0}, - 787: {region: 0x164, script: 0x52, flags: 0x0}, - 788: {region: 0x164, script: 0x52, flags: 0x0}, - 789: {region: 0x164, script: 0x52, flags: 0x0}, - 790: {region: 0x164, script: 0x52, flags: 0x0}, - 791: {region: 0x164, script: 0x52, flags: 0x0}, - 792: {region: 0x164, script: 0x52, flags: 0x0}, - 793: {region: 0x98, script: 0x20, flags: 0x0}, - 794: {region: 0xda, script: 0x20, flags: 0x0}, - 795: {region: 0x105, script: 0x1e, flags: 0x0}, - 796: {region: 0x34, script: 0x68, flags: 0x0}, - 797: {region: 0x29, script: 0x3, flags: 0x1}, - 798: {region: 0xca, script: 0x52, flags: 0x0}, - 799: {region: 0x164, script: 0x52, flags: 0x0}, - 800: {region: 0x164, script: 0x52, flags: 0x0}, - 801: {region: 0x164, script: 0x52, flags: 0x0}, - 802: {region: 0x98, script: 0x20, flags: 0x0}, - 803: {region: 0x51, script: 0x52, flags: 0x0}, - 805: {region: 0x164, script: 0x52, flags: 0x0}, - 806: {region: 0x134, script: 0x52, flags: 0x0}, - 807: {region: 0x164, script: 0x52, flags: 0x0}, - 808: {region: 0x164, script: 0x52, flags: 0x0}, - 809: {region: 0xe7, script: 0x5, flags: 0x0}, - 810: {region: 0xc2, script: 0x52, flags: 0x0}, - 811: {region: 0x98, script: 0x20, flags: 0x0}, - 812: {region: 0x94, script: 0x52, flags: 0x0}, - 813: {region: 0x163, script: 0x52, flags: 0x0}, - 814: {region: 0x164, script: 0x52, flags: 0x0}, - 815: {region: 0xc3, script: 0x6b, flags: 0x0}, - 816: {region: 0x164, script: 0x52, flags: 0x0}, - 817: {region: 0x164, script: 0x27, flags: 0x0}, - 818: {region: 0x105, script: 0x1e, flags: 0x0}, - 819: {region: 0x164, script: 0x52, flags: 0x0}, - 820: {region: 0x130, script: 0x52, flags: 0x0}, - 821: {region: 0x9b, script: 0x5d, flags: 0x0}, - 822: {region: 0x164, script: 0x52, flags: 0x0}, - 823: {region: 0x164, script: 0x52, flags: 0x0}, - 824: {region: 0x9b, script: 0x5, flags: 0x0}, - 825: {region: 0x164, script: 0x52, flags: 0x0}, - 826: {region: 0x164, script: 0x52, flags: 0x0}, - 827: {region: 0x164, script: 0x52, flags: 0x0}, - 828: {region: 0xdc, script: 0x52, flags: 0x0}, - 829: {region: 0x164, script: 0x52, flags: 0x0}, - 830: {region: 0x164, script: 0x52, flags: 0x0}, - 832: {region: 0x164, script: 0x52, flags: 0x0}, - 833: {region: 0x52, script: 0x34, flags: 0x0}, - 834: {region: 0x9d, script: 0x52, flags: 0x0}, - 835: {region: 0xd1, script: 0x52, flags: 0x0}, - 836: {region: 0x164, script: 0x52, flags: 0x0}, - 837: {region: 0xd9, script: 0x52, flags: 0x0}, - 838: {region: 0x164, script: 0x52, flags: 0x0}, - 839: {region: 0x164, script: 0x52, flags: 0x0}, - 840: {region: 0x164, script: 0x52, flags: 0x0}, - 841: {region: 0xce, script: 0x52, flags: 0x0}, - 842: {region: 0x164, script: 0x52, flags: 0x0}, - 843: {region: 0x164, script: 0x52, flags: 0x0}, - 844: {region: 0x163, script: 0x52, flags: 0x0}, - 845: {region: 0xd0, script: 0x52, flags: 0x0}, - 846: {region: 0x5f, script: 0x52, flags: 0x0}, - 847: {region: 0xda, script: 0x20, flags: 0x0}, - 848: {region: 0x164, script: 0x52, flags: 0x0}, - 849: {region: 0xda, script: 0x20, flags: 0x0}, - 850: {region: 0x164, script: 0x52, flags: 0x0}, - 851: {region: 0x164, script: 0x52, flags: 0x0}, - 852: {region: 0xd1, script: 0x52, flags: 0x0}, - 853: {region: 0x164, script: 0x52, flags: 0x0}, - 854: {region: 0x164, script: 0x52, flags: 0x0}, - 855: {region: 0xd0, script: 0x52, flags: 0x0}, - 856: {region: 0x164, script: 0x52, flags: 0x0}, - 857: {region: 0xce, script: 0x52, flags: 0x0}, - 858: {region: 0xce, script: 0x52, flags: 0x0}, - 859: {region: 0x164, script: 0x52, flags: 0x0}, - 860: {region: 0x164, script: 0x52, flags: 0x0}, - 861: {region: 0x94, script: 0x52, flags: 0x0}, - 862: {region: 0x164, script: 0x52, flags: 0x0}, - 863: {region: 0xde, script: 0x52, flags: 0x0}, - 864: {region: 0x164, script: 0x52, flags: 0x0}, - 865: {region: 0x164, script: 0x52, flags: 0x0}, - 866: {region: 0x98, script: 0x52, flags: 0x0}, - 867: {region: 0x164, script: 0x52, flags: 0x0}, - 868: {region: 0x164, script: 0x52, flags: 0x0}, - 869: {region: 0xd8, script: 0x52, flags: 0x0}, - 870: {region: 0x51, script: 0x52, flags: 0x0}, - 871: {region: 0x164, script: 0x52, flags: 0x0}, - 872: {region: 0xd9, script: 0x52, flags: 0x0}, - 873: {region: 0x164, script: 0x52, flags: 0x0}, - 874: {region: 0x51, script: 0x52, flags: 0x0}, - 875: {region: 0x164, script: 0x52, flags: 0x0}, - 876: {region: 0x164, script: 0x52, flags: 0x0}, - 877: {region: 0xd9, script: 0x52, flags: 0x0}, - 878: {region: 0x122, script: 0x4e, flags: 0x0}, - 879: {region: 0x98, script: 0x20, flags: 0x0}, - 880: {region: 0x10b, script: 0xb7, flags: 0x0}, - 881: {region: 0x164, script: 0x52, flags: 0x0}, - 882: {region: 0x164, script: 0x52, flags: 0x0}, - 883: {region: 0x83, script: 0x70, flags: 0x0}, - 884: {region: 0x160, script: 0x52, flags: 0x0}, - 885: {region: 0x164, script: 0x52, flags: 0x0}, - 886: {region: 0x48, script: 0x17, flags: 0x0}, - 887: {region: 0x164, script: 0x52, flags: 0x0}, - 888: {region: 0x160, script: 0x52, flags: 0x0}, - 889: {region: 0x164, script: 0x52, flags: 0x0}, - 890: {region: 0x164, script: 0x52, flags: 0x0}, - 891: {region: 0x164, script: 0x52, flags: 0x0}, - 892: {region: 0x164, script: 0x52, flags: 0x0}, - 893: {region: 0x164, script: 0x52, flags: 0x0}, - 894: {region: 0x116, script: 0x52, flags: 0x0}, - 895: {region: 0x164, script: 0x52, flags: 0x0}, - 896: {region: 0x164, script: 0x52, flags: 0x0}, - 897: {region: 0x134, script: 0x52, flags: 0x0}, - 898: {region: 0x164, script: 0x52, flags: 0x0}, - 899: {region: 0x52, script: 0x52, flags: 0x0}, - 900: {region: 0x164, script: 0x52, flags: 0x0}, - 901: {region: 0xcd, script: 0x52, flags: 0x0}, - 902: {region: 0x12e, script: 0x52, flags: 0x0}, - 903: {region: 0x130, script: 0x52, flags: 0x0}, - 904: {region: 0x7f, script: 0x52, flags: 0x0}, - 905: {region: 0x77, script: 0x52, flags: 0x0}, - 906: {region: 0x164, script: 0x52, flags: 0x0}, - 908: {region: 0x164, script: 0x52, flags: 0x0}, - 909: {region: 0x164, script: 0x52, flags: 0x0}, - 910: {region: 0x6e, script: 0x52, flags: 0x0}, - 911: {region: 0x164, script: 0x52, flags: 0x0}, - 912: {region: 0x164, script: 0x52, flags: 0x0}, - 913: {region: 0x164, script: 0x52, flags: 0x0}, - 914: {region: 0x164, script: 0x52, flags: 0x0}, - 915: {region: 0x98, script: 0x75, flags: 0x0}, - 916: {region: 0x164, script: 0x52, flags: 0x0}, - 917: {region: 0x164, script: 0x5, flags: 0x0}, - 918: {region: 0x7c, script: 0x1e, flags: 0x0}, - 919: {region: 0x134, script: 0x76, flags: 0x0}, - 920: {region: 0x164, script: 0x5, flags: 0x0}, - 921: {region: 0xc4, script: 0x74, flags: 0x0}, - 922: {region: 0x164, script: 0x52, flags: 0x0}, - 923: {region: 0x2c, script: 0x3, flags: 0x1}, - 924: {region: 0xe6, script: 0x52, flags: 0x0}, - 925: {region: 0x2f, script: 0x2, flags: 0x1}, - 926: {region: 0xe6, script: 0x52, flags: 0x0}, - 927: {region: 0x2f, script: 0x52, flags: 0x0}, - 928: {region: 0xef, script: 0x52, flags: 0x0}, - 929: {region: 0x164, script: 0x52, flags: 0x0}, - 930: {region: 0x77, script: 0x52, flags: 0x0}, - 931: {region: 0xd5, script: 0x52, flags: 0x0}, - 932: {region: 0x134, script: 0x52, flags: 0x0}, - 933: {region: 0x48, script: 0x52, flags: 0x0}, - 934: {region: 0x164, script: 0x52, flags: 0x0}, - 935: {region: 0x9b, script: 0xdd, flags: 0x0}, - 936: {region: 0x164, script: 0x52, flags: 0x0}, - 937: {region: 0x5f, script: 0x52, flags: 0x0}, - 938: {region: 0x164, script: 0x5, flags: 0x0}, - 939: {region: 0xaf, script: 0x7f, flags: 0x0}, - 941: {region: 0x164, script: 0x52, flags: 0x0}, - 942: {region: 0x164, script: 0x52, flags: 0x0}, - 943: {region: 0x98, script: 0x12, flags: 0x0}, - 944: {region: 0xa3, script: 0x52, flags: 0x0}, - 945: {region: 0xe8, script: 0x52, flags: 0x0}, - 946: {region: 0x164, script: 0x52, flags: 0x0}, - 947: {region: 0x9d, script: 0x52, flags: 0x0}, - 948: {region: 0x164, script: 0x52, flags: 0x0}, - 949: {region: 0x164, script: 0x52, flags: 0x0}, - 950: {region: 0x86, script: 0x2d, flags: 0x0}, - 951: {region: 0x74, script: 0x52, flags: 0x0}, - 952: {region: 0x164, script: 0x52, flags: 0x0}, - 953: {region: 0xe7, script: 0x45, flags: 0x0}, - 954: {region: 0x9b, script: 0x5, flags: 0x0}, - 955: {region: 0x1, script: 0x52, flags: 0x0}, - 956: {region: 0x23, script: 0x5, flags: 0x0}, - 957: {region: 0x164, script: 0x52, flags: 0x0}, - 958: {region: 0x40, script: 0x52, flags: 0x0}, - 959: {region: 0x164, script: 0x52, flags: 0x0}, - 960: {region: 0x79, script: 0x52, flags: 0x0}, - 961: {region: 0x164, script: 0x52, flags: 0x0}, - 962: {region: 0xe3, script: 0x52, flags: 0x0}, - 963: {region: 0x88, script: 0x52, flags: 0x0}, - 964: {region: 0x68, script: 0x52, flags: 0x0}, - 965: {region: 0x164, script: 0x52, flags: 0x0}, - 966: {region: 0x98, script: 0x20, flags: 0x0}, - 967: {region: 0x164, script: 0x52, flags: 0x0}, - 968: {region: 0x101, script: 0x52, flags: 0x0}, - 969: {region: 0x94, script: 0x52, flags: 0x0}, - 970: {region: 0x164, script: 0x52, flags: 0x0}, - 971: {region: 0x164, script: 0x52, flags: 0x0}, - 972: {region: 0x9d, script: 0x52, flags: 0x0}, - 973: {region: 0x164, script: 0x5, flags: 0x0}, - 974: {region: 0x98, script: 0x52, flags: 0x0}, - 975: {region: 0x31, script: 0x2, flags: 0x1}, - 976: {region: 0xda, script: 0x20, flags: 0x0}, - 977: {region: 0x34, script: 0xe, flags: 0x0}, - 978: {region: 0x4d, script: 0x52, flags: 0x0}, - 979: {region: 0x71, script: 0x52, flags: 0x0}, - 980: {region: 0x4d, script: 0x52, flags: 0x0}, - 981: {region: 0x9b, script: 0x5, flags: 0x0}, - 982: {region: 0x10b, script: 0x52, flags: 0x0}, - 983: {region: 0x39, script: 0x52, flags: 0x0}, - 984: {region: 0x164, script: 0x52, flags: 0x0}, - 985: {region: 0xd0, script: 0x52, flags: 0x0}, - 986: {region: 0x103, script: 0x52, flags: 0x0}, - 987: {region: 0x94, script: 0x52, flags: 0x0}, - 988: {region: 0x12e, script: 0x52, flags: 0x0}, - 989: {region: 0x164, script: 0x52, flags: 0x0}, - 990: {region: 0x164, script: 0x52, flags: 0x0}, - 991: {region: 0x72, script: 0x52, flags: 0x0}, - 992: {region: 0x105, script: 0x1e, flags: 0x0}, - 993: {region: 0x12f, script: 0x1e, flags: 0x0}, - 994: {region: 0x108, script: 0x52, flags: 0x0}, - 995: {region: 0x106, script: 0x52, flags: 0x0}, - 996: {region: 0x12e, script: 0x52, flags: 0x0}, - 997: {region: 0x164, script: 0x52, flags: 0x0}, - 998: {region: 0xa1, script: 0x44, flags: 0x0}, - 999: {region: 0x98, script: 0x20, flags: 0x0}, - 1000: {region: 0x7f, script: 0x52, flags: 0x0}, - 1001: {region: 0x105, script: 0x1e, flags: 0x0}, - 1002: {region: 0xa3, script: 0x52, flags: 0x0}, - 1003: {region: 0x94, script: 0x52, flags: 0x0}, - 1004: {region: 0x98, script: 0x52, flags: 0x0}, - 1005: {region: 0x113, script: 0x52, flags: 0x0}, - 1006: {region: 0x98, script: 0xbb, flags: 0x0}, - 1007: {region: 0x164, script: 0x52, flags: 0x0}, - 1008: {region: 0x164, script: 0x52, flags: 0x0}, - 1009: {region: 0x12e, script: 0x52, flags: 0x0}, - 1010: {region: 0x9d, script: 0x52, flags: 0x0}, - 1011: {region: 0x98, script: 0x20, flags: 0x0}, - 1012: {region: 0x164, script: 0x5, flags: 0x0}, - 1013: {region: 0x9d, script: 0x52, flags: 0x0}, - 1014: {region: 0x7a, script: 0x52, flags: 0x0}, - 1015: {region: 0x48, script: 0x52, flags: 0x0}, - 1016: {region: 0x33, script: 0x4, flags: 0x1}, - 1017: {region: 0x9d, script: 0x52, flags: 0x0}, - 1018: {region: 0x9b, script: 0x5, flags: 0x0}, - 1019: {region: 0xd9, script: 0x52, flags: 0x0}, - 1020: {region: 0x4e, script: 0x52, flags: 0x0}, - 1021: {region: 0xd0, script: 0x52, flags: 0x0}, - 1022: {region: 0xce, script: 0x52, flags: 0x0}, - 1023: {region: 0xc2, script: 0x52, flags: 0x0}, - 1024: {region: 0x4b, script: 0x52, flags: 0x0}, - 1025: {region: 0x95, script: 0x72, flags: 0x0}, - 1026: {region: 0xb5, script: 0x52, flags: 0x0}, - 1027: {region: 0x164, script: 0x27, flags: 0x0}, - 1028: {region: 0x164, script: 0x52, flags: 0x0}, - 1030: {region: 0xb9, script: 0xd2, flags: 0x0}, - 1031: {region: 0x164, script: 0x52, flags: 0x0}, - 1032: {region: 0xc3, script: 0x6b, flags: 0x0}, - 1033: {region: 0x164, script: 0x5, flags: 0x0}, - 1034: {region: 0xb2, script: 0xc1, flags: 0x0}, - 1035: {region: 0x6e, script: 0x52, flags: 0x0}, - 1036: {region: 0x164, script: 0x52, flags: 0x0}, - 1037: {region: 0x164, script: 0x52, flags: 0x0}, - 1038: {region: 0x164, script: 0x52, flags: 0x0}, - 1039: {region: 0x164, script: 0x52, flags: 0x0}, - 1040: {region: 0x110, script: 0x52, flags: 0x0}, - 1041: {region: 0x164, script: 0x52, flags: 0x0}, - 1042: {region: 0xe7, script: 0x5, flags: 0x0}, - 1043: {region: 0x164, script: 0x52, flags: 0x0}, - 1044: {region: 0x10e, script: 0x52, flags: 0x0}, - 1045: {region: 0x164, script: 0x52, flags: 0x0}, - 1046: {region: 0xe8, script: 0x52, flags: 0x0}, - 1047: {region: 0x164, script: 0x52, flags: 0x0}, - 1048: {region: 0x94, script: 0x52, flags: 0x0}, - 1049: {region: 0x141, script: 0x52, flags: 0x0}, - 1050: {region: 0x10b, script: 0x52, flags: 0x0}, - 1052: {region: 0x10b, script: 0x52, flags: 0x0}, - 1053: {region: 0x71, script: 0x52, flags: 0x0}, - 1054: {region: 0x96, script: 0xb8, flags: 0x0}, - 1055: {region: 0x164, script: 0x52, flags: 0x0}, - 1056: {region: 0x71, script: 0x52, flags: 0x0}, - 1057: {region: 0x163, script: 0x52, flags: 0x0}, - 1058: {region: 0x164, script: 0x52, flags: 0x0}, - 1059: {region: 0xc2, script: 0x52, flags: 0x0}, - 1060: {region: 0x164, script: 0x52, flags: 0x0}, - 1061: {region: 0x164, script: 0x52, flags: 0x0}, - 1062: {region: 0x164, script: 0x52, flags: 0x0}, - 1063: {region: 0x114, script: 0x52, flags: 0x0}, - 1064: {region: 0x164, script: 0x52, flags: 0x0}, - 1065: {region: 0x164, script: 0x52, flags: 0x0}, - 1066: {region: 0x122, script: 0xd5, flags: 0x0}, - 1067: {region: 0x164, script: 0x52, flags: 0x0}, - 1068: {region: 0x164, script: 0x52, flags: 0x0}, - 1069: {region: 0x164, script: 0x52, flags: 0x0}, - 1070: {region: 0x164, script: 0x52, flags: 0x0}, - 1071: {region: 0x26, script: 0x52, flags: 0x0}, - 1072: {region: 0x37, script: 0x5, flags: 0x1}, - 1073: {region: 0x98, script: 0xc2, flags: 0x0}, - 1074: {region: 0x115, script: 0x52, flags: 0x0}, - 1075: {region: 0x113, script: 0x52, flags: 0x0}, - 1076: {region: 0x98, script: 0x20, flags: 0x0}, - 1077: {region: 0x160, script: 0x52, flags: 0x0}, - 1078: {region: 0x164, script: 0x52, flags: 0x0}, - 1079: {region: 0x164, script: 0x52, flags: 0x0}, - 1080: {region: 0x6c, script: 0x52, flags: 0x0}, - 1081: {region: 0x160, script: 0x52, flags: 0x0}, - 1082: {region: 0x164, script: 0x52, flags: 0x0}, - 1083: {region: 0x5f, script: 0x52, flags: 0x0}, - 1084: {region: 0x94, script: 0x52, flags: 0x0}, - 1085: {region: 0x164, script: 0x52, flags: 0x0}, - 1086: {region: 0x164, script: 0x52, flags: 0x0}, - 1087: {region: 0x12e, script: 0x52, flags: 0x0}, - 1088: {region: 0x164, script: 0x52, flags: 0x0}, - 1089: {region: 0x83, script: 0x52, flags: 0x0}, - 1090: {region: 0x10b, script: 0x52, flags: 0x0}, - 1091: {region: 0x12e, script: 0x52, flags: 0x0}, - 1092: {region: 0x15e, script: 0x5, flags: 0x0}, - 1093: {region: 0x4a, script: 0x52, flags: 0x0}, - 1094: {region: 0x5f, script: 0x52, flags: 0x0}, - 1095: {region: 0x164, script: 0x52, flags: 0x0}, - 1096: {region: 0x98, script: 0x20, flags: 0x0}, - 1097: {region: 0x94, script: 0x52, flags: 0x0}, - 1098: {region: 0x164, script: 0x52, flags: 0x0}, - 1099: {region: 0x34, script: 0xe, flags: 0x0}, - 1100: {region: 0x9a, script: 0xc5, flags: 0x0}, - 1101: {region: 0xe8, script: 0x52, flags: 0x0}, - 1102: {region: 0x98, script: 0xcd, flags: 0x0}, - 1103: {region: 0xda, script: 0x20, flags: 0x0}, - 1104: {region: 0x164, script: 0x52, flags: 0x0}, - 1105: {region: 0x164, script: 0x52, flags: 0x0}, - 1106: {region: 0x164, script: 0x52, flags: 0x0}, - 1107: {region: 0x164, script: 0x52, flags: 0x0}, - 1108: {region: 0x164, script: 0x52, flags: 0x0}, - 1109: {region: 0x164, script: 0x52, flags: 0x0}, - 1110: {region: 0x164, script: 0x52, flags: 0x0}, - 1111: {region: 0x164, script: 0x52, flags: 0x0}, - 1112: {region: 0xe6, script: 0x52, flags: 0x0}, - 1113: {region: 0x164, script: 0x52, flags: 0x0}, - 1114: {region: 0x164, script: 0x52, flags: 0x0}, - 1115: {region: 0x98, script: 0x4a, flags: 0x0}, - 1116: {region: 0x52, script: 0xcb, flags: 0x0}, - 1117: {region: 0xda, script: 0x20, flags: 0x0}, - 1118: {region: 0xda, script: 0x20, flags: 0x0}, - 1119: {region: 0x98, script: 0xd0, flags: 0x0}, - 1120: {region: 0x164, script: 0x52, flags: 0x0}, - 1121: {region: 0x111, script: 0x52, flags: 0x0}, - 1122: {region: 0x130, script: 0x52, flags: 0x0}, - 1123: {region: 0x125, script: 0x52, flags: 0x0}, - 1124: {region: 0x164, script: 0x52, flags: 0x0}, - 1125: {region: 0x3c, script: 0x3, flags: 0x1}, - 1126: {region: 0x164, script: 0x52, flags: 0x0}, - 1127: {region: 0x164, script: 0x52, flags: 0x0}, - 1128: {region: 0x164, script: 0x52, flags: 0x0}, - 1129: {region: 0x122, script: 0xd5, flags: 0x0}, - 1130: {region: 0xda, script: 0x20, flags: 0x0}, - 1131: {region: 0xda, script: 0x20, flags: 0x0}, - 1132: {region: 0xda, script: 0x20, flags: 0x0}, - 1133: {region: 0x6e, script: 0x27, flags: 0x0}, - 1134: {region: 0x164, script: 0x52, flags: 0x0}, - 1135: {region: 0x6c, script: 0x27, flags: 0x0}, - 1136: {region: 0x164, script: 0x52, flags: 0x0}, - 1137: {region: 0x164, script: 0x52, flags: 0x0}, - 1138: {region: 0x164, script: 0x52, flags: 0x0}, - 1139: {region: 0xd5, script: 0x52, flags: 0x0}, - 1140: {region: 0x126, script: 0x52, flags: 0x0}, - 1141: {region: 0x124, script: 0x52, flags: 0x0}, - 1142: {region: 0x31, script: 0x52, flags: 0x0}, - 1143: {region: 0xda, script: 0x20, flags: 0x0}, - 1144: {region: 0xe6, script: 0x52, flags: 0x0}, - 1145: {region: 0x164, script: 0x52, flags: 0x0}, - 1146: {region: 0x164, script: 0x52, flags: 0x0}, - 1147: {region: 0x31, script: 0x52, flags: 0x0}, - 1148: {region: 0xd3, script: 0x52, flags: 0x0}, - 1149: {region: 0x164, script: 0x52, flags: 0x0}, - 1150: {region: 0x160, script: 0x52, flags: 0x0}, - 1151: {region: 0x164, script: 0x52, flags: 0x0}, - 1152: {region: 0x128, script: 0x52, flags: 0x0}, - 1153: {region: 0x164, script: 0x52, flags: 0x0}, - 1154: {region: 0xcd, script: 0x52, flags: 0x0}, - 1155: {region: 0x164, script: 0x52, flags: 0x0}, - 1156: {region: 0xe5, script: 0x52, flags: 0x0}, - 1157: {region: 0x164, script: 0x52, flags: 0x0}, - 1158: {region: 0x164, script: 0x52, flags: 0x0}, - 1159: {region: 0x164, script: 0x52, flags: 0x0}, - 1160: {region: 0x12a, script: 0x52, flags: 0x0}, - 1161: {region: 0x12a, script: 0x52, flags: 0x0}, - 1162: {region: 0x12d, script: 0x52, flags: 0x0}, - 1163: {region: 0x164, script: 0x5, flags: 0x0}, - 1164: {region: 0x160, script: 0x52, flags: 0x0}, - 1165: {region: 0x86, script: 0x2d, flags: 0x0}, - 1166: {region: 0xda, script: 0x20, flags: 0x0}, - 1167: {region: 0xe6, script: 0x52, flags: 0x0}, - 1168: {region: 0x42, script: 0xd6, flags: 0x0}, - 1169: {region: 0x164, script: 0x52, flags: 0x0}, - 1170: {region: 0x105, script: 0x1e, flags: 0x0}, - 1171: {region: 0x164, script: 0x52, flags: 0x0}, - 1172: {region: 0x164, script: 0x52, flags: 0x0}, - 1173: {region: 0x130, script: 0x52, flags: 0x0}, - 1174: {region: 0x164, script: 0x52, flags: 0x0}, - 1175: {region: 0x122, script: 0xd5, flags: 0x0}, - 1176: {region: 0x31, script: 0x52, flags: 0x0}, - 1177: {region: 0x164, script: 0x52, flags: 0x0}, - 1178: {region: 0x164, script: 0x52, flags: 0x0}, - 1179: {region: 0xcd, script: 0x52, flags: 0x0}, - 1180: {region: 0x164, script: 0x52, flags: 0x0}, - 1181: {region: 0x164, script: 0x52, flags: 0x0}, - 1182: {region: 0x12c, script: 0x52, flags: 0x0}, - 1183: {region: 0x164, script: 0x52, flags: 0x0}, - 1185: {region: 0x164, script: 0x52, flags: 0x0}, - 1186: {region: 0xd3, script: 0x52, flags: 0x0}, - 1187: {region: 0x52, script: 0xce, flags: 0x0}, - 1188: {region: 0xe4, script: 0x52, flags: 0x0}, - 1189: {region: 0x164, script: 0x52, flags: 0x0}, - 1190: {region: 0x105, script: 0x1e, flags: 0x0}, - 1191: {region: 0xb9, script: 0x52, flags: 0x0}, - 1192: {region: 0x164, script: 0x52, flags: 0x0}, - 1193: {region: 0x105, script: 0x1e, flags: 0x0}, - 1194: {region: 0x3f, script: 0x4, flags: 0x1}, - 1195: {region: 0x11b, script: 0xd8, flags: 0x0}, - 1196: {region: 0x12f, script: 0x1e, flags: 0x0}, - 1197: {region: 0x74, script: 0x52, flags: 0x0}, - 1198: {region: 0x29, script: 0x52, flags: 0x0}, - 1200: {region: 0x43, script: 0x3, flags: 0x1}, - 1201: {region: 0x98, script: 0xe, flags: 0x0}, - 1202: {region: 0xe7, script: 0x5, flags: 0x0}, - 1203: {region: 0x164, script: 0x52, flags: 0x0}, - 1204: {region: 0x164, script: 0x52, flags: 0x0}, - 1205: {region: 0x164, script: 0x52, flags: 0x0}, - 1206: {region: 0x164, script: 0x52, flags: 0x0}, - 1207: {region: 0x164, script: 0x52, flags: 0x0}, - 1208: {region: 0x164, script: 0x52, flags: 0x0}, - 1209: {region: 0x164, script: 0x52, flags: 0x0}, - 1210: {region: 0x46, script: 0x4, flags: 0x1}, - 1211: {region: 0x164, script: 0x52, flags: 0x0}, - 1212: {region: 0xb3, script: 0xd9, flags: 0x0}, - 1213: {region: 0x164, script: 0x52, flags: 0x0}, - 1214: {region: 0x160, script: 0x52, flags: 0x0}, - 1215: {region: 0x9d, script: 0x52, flags: 0x0}, - 1216: {region: 0x105, script: 0x52, flags: 0x0}, - 1217: {region: 0x13d, script: 0x52, flags: 0x0}, - 1218: {region: 0x11a, script: 0x52, flags: 0x0}, - 1219: {region: 0x164, script: 0x52, flags: 0x0}, - 1220: {region: 0x35, script: 0x52, flags: 0x0}, - 1221: {region: 0x5f, script: 0x52, flags: 0x0}, - 1222: {region: 0xd0, script: 0x52, flags: 0x0}, - 1223: {region: 0x1, script: 0x52, flags: 0x0}, - 1224: {region: 0x105, script: 0x52, flags: 0x0}, - 1225: {region: 0x69, script: 0x52, flags: 0x0}, - 1226: {region: 0x12e, script: 0x52, flags: 0x0}, - 1227: {region: 0x164, script: 0x52, flags: 0x0}, - 1228: {region: 0x35, script: 0x52, flags: 0x0}, - 1229: {region: 0x4d, script: 0x52, flags: 0x0}, - 1230: {region: 0x164, script: 0x52, flags: 0x0}, - 1231: {region: 0x6e, script: 0x27, flags: 0x0}, - 1232: {region: 0x164, script: 0x52, flags: 0x0}, - 1233: {region: 0xe6, script: 0x52, flags: 0x0}, - 1234: {region: 0x2e, script: 0x52, flags: 0x0}, - 1235: {region: 0x98, script: 0xd0, flags: 0x0}, - 1236: {region: 0x98, script: 0x20, flags: 0x0}, - 1237: {region: 0x164, script: 0x52, flags: 0x0}, - 1238: {region: 0x164, script: 0x52, flags: 0x0}, - 1239: {region: 0x164, script: 0x52, flags: 0x0}, - 1240: {region: 0x164, script: 0x52, flags: 0x0}, - 1241: {region: 0x164, script: 0x52, flags: 0x0}, - 1242: {region: 0x164, script: 0x52, flags: 0x0}, - 1243: {region: 0x164, script: 0x52, flags: 0x0}, - 1244: {region: 0x164, script: 0x52, flags: 0x0}, - 1245: {region: 0x164, script: 0x52, flags: 0x0}, - 1246: {region: 0x13f, script: 0x52, flags: 0x0}, - 1247: {region: 0x164, script: 0x52, flags: 0x0}, - 1248: {region: 0x164, script: 0x52, flags: 0x0}, - 1249: {region: 0xa7, script: 0x5, flags: 0x0}, - 1250: {region: 0x164, script: 0x52, flags: 0x0}, - 1251: {region: 0x113, script: 0x52, flags: 0x0}, - 1252: {region: 0x164, script: 0x52, flags: 0x0}, - 1253: {region: 0x164, script: 0x52, flags: 0x0}, - 1254: {region: 0x164, script: 0x52, flags: 0x0}, - 1255: {region: 0x164, script: 0x52, flags: 0x0}, - 1256: {region: 0x98, script: 0x20, flags: 0x0}, - 1257: {region: 0x52, script: 0x34, flags: 0x0}, - 1258: {region: 0x164, script: 0x52, flags: 0x0}, - 1259: {region: 0x164, script: 0x52, flags: 0x0}, - 1260: {region: 0x40, script: 0x52, flags: 0x0}, - 1261: {region: 0x164, script: 0x52, flags: 0x0}, - 1262: {region: 0x12a, script: 0x18, flags: 0x0}, - 1263: {region: 0x164, script: 0x52, flags: 0x0}, - 1264: {region: 0x160, script: 0x52, flags: 0x0}, - 1265: {region: 0x164, script: 0x52, flags: 0x0}, - 1266: {region: 0x12a, script: 0x5a, flags: 0x0}, - 1267: {region: 0x12a, script: 0x5b, flags: 0x0}, - 1268: {region: 0x7c, script: 0x29, flags: 0x0}, - 1269: {region: 0x52, script: 0x5e, flags: 0x0}, - 1270: {region: 0x10a, script: 0x62, flags: 0x0}, - 1271: {region: 0x107, script: 0x6c, flags: 0x0}, - 1272: {region: 0x98, script: 0x20, flags: 0x0}, - 1273: {region: 0x130, script: 0x52, flags: 0x0}, - 1274: {region: 0x164, script: 0x52, flags: 0x0}, - 1275: {region: 0x9b, script: 0x82, flags: 0x0}, - 1276: {region: 0x164, script: 0x52, flags: 0x0}, - 1277: {region: 0x15d, script: 0xba, flags: 0x0}, - 1278: {region: 0x164, script: 0x52, flags: 0x0}, - 1279: {region: 0x164, script: 0x52, flags: 0x0}, - 1280: {region: 0xda, script: 0x20, flags: 0x0}, - 1281: {region: 0x164, script: 0x52, flags: 0x0}, - 1282: {region: 0x164, script: 0x52, flags: 0x0}, - 1283: {region: 0xd0, script: 0x52, flags: 0x0}, - 1284: {region: 0x74, script: 0x52, flags: 0x0}, - 1285: {region: 0x164, script: 0x52, flags: 0x0}, - 1286: {region: 0x164, script: 0x52, flags: 0x0}, - 1287: {region: 0x51, script: 0x52, flags: 0x0}, - 1288: {region: 0x164, script: 0x52, flags: 0x0}, - 1289: {region: 0x164, script: 0x52, flags: 0x0}, - 1290: {region: 0x164, script: 0x52, flags: 0x0}, - 1291: {region: 0x51, script: 0x52, flags: 0x0}, - 1292: {region: 0x164, script: 0x52, flags: 0x0}, - 1293: {region: 0x164, script: 0x52, flags: 0x0}, - 1294: {region: 0x164, script: 0x52, flags: 0x0}, - 1295: {region: 0x164, script: 0x52, flags: 0x0}, - 1296: {region: 0x1, script: 0x37, flags: 0x0}, - 1297: {region: 0x164, script: 0x52, flags: 0x0}, - 1298: {region: 0x164, script: 0x52, flags: 0x0}, - 1299: {region: 0x164, script: 0x52, flags: 0x0}, - 1300: {region: 0x164, script: 0x52, flags: 0x0}, - 1301: {region: 0x164, script: 0x52, flags: 0x0}, - 1302: {region: 0xd5, script: 0x52, flags: 0x0}, - 1303: {region: 0x164, script: 0x52, flags: 0x0}, - 1304: {region: 0x164, script: 0x52, flags: 0x0}, - 1305: {region: 0x164, script: 0x52, flags: 0x0}, - 1306: {region: 0x40, script: 0x52, flags: 0x0}, - 1307: {region: 0x164, script: 0x52, flags: 0x0}, - 1308: {region: 0xce, script: 0x52, flags: 0x0}, - 1309: {region: 0x4a, script: 0x3, flags: 0x1}, - 1310: {region: 0x164, script: 0x52, flags: 0x0}, - 1311: {region: 0x164, script: 0x52, flags: 0x0}, - 1312: {region: 0x164, script: 0x52, flags: 0x0}, - 1313: {region: 0x52, script: 0x52, flags: 0x0}, - 1314: {region: 0x10a, script: 0x52, flags: 0x0}, - 1316: {region: 0xa7, script: 0x5, flags: 0x0}, - 1317: {region: 0xd8, script: 0x52, flags: 0x0}, - 1318: {region: 0xb9, script: 0xd2, flags: 0x0}, - 1319: {region: 0x4d, script: 0x14, flags: 0x1}, - 1320: {region: 0x164, script: 0x52, flags: 0x0}, - 1321: {region: 0x121, script: 0x52, flags: 0x0}, - 1322: {region: 0xcf, script: 0x52, flags: 0x0}, - 1323: {region: 0x164, script: 0x52, flags: 0x0}, - 1324: {region: 0x160, script: 0x52, flags: 0x0}, - 1326: {region: 0x12a, script: 0x52, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9b, script: 0x7, flags: 0x0}, - 1: {region: 0xa0, script: 0x6d, flags: 0x2}, - 2: {region: 0x11b, script: 0x78, flags: 0x2}, - 3: {region: 0x31, script: 0x52, flags: 0x0}, - 4: {region: 0x9a, script: 0x5, flags: 0x4}, - 5: {region: 0x9b, script: 0x5, flags: 0x4}, - 6: {region: 0x105, script: 0x1e, flags: 0x4}, - 7: {region: 0x9b, script: 0x5, flags: 0x2}, - 8: {region: 0x105, script: 0x1e, flags: 0x0}, - 9: {region: 0x37, script: 0x2a, flags: 0x2}, - 10: {region: 0x134, script: 0x52, flags: 0x0}, - 11: {region: 0x7a, script: 0xbd, flags: 0x2}, - 12: {region: 0x113, script: 0x52, flags: 0x0}, - 13: {region: 0x83, script: 0x1, flags: 0x2}, - 14: {region: 0x5c, script: 0x1d, flags: 0x0}, - 15: {region: 0x86, script: 0x57, flags: 0x2}, - 16: {region: 0xd5, script: 0x52, flags: 0x0}, - 17: {region: 0x51, script: 0x5, flags: 0x4}, - 18: {region: 0x10a, script: 0x5, flags: 0x4}, - 19: {region: 0xad, script: 0x1e, flags: 0x0}, - 20: {region: 0x23, script: 0x5, flags: 0x4}, - 21: {region: 0x52, script: 0x5, flags: 0x4}, - 22: {region: 0x9b, script: 0x5, flags: 0x4}, - 23: {region: 0xc4, script: 0x5, flags: 0x4}, - 24: {region: 0x52, script: 0x5, flags: 0x2}, - 25: {region: 0x12a, script: 0x52, flags: 0x0}, - 26: {region: 0xaf, script: 0x5, flags: 0x4}, - 27: {region: 0x9a, script: 0x5, flags: 0x2}, - 28: {region: 0xa4, script: 0x1e, flags: 0x0}, - 29: {region: 0x52, script: 0x5, flags: 0x4}, - 30: {region: 0x12a, script: 0x52, flags: 0x4}, - 31: {region: 0x52, script: 0x5, flags: 0x2}, - 32: {region: 0x12a, script: 0x52, flags: 0x2}, - 33: {region: 0xda, script: 0x20, flags: 0x0}, - 34: {region: 0x98, script: 0x55, flags: 0x2}, - 35: {region: 0x82, script: 0x52, flags: 0x0}, - 36: {region: 0x83, script: 0x70, flags: 0x4}, - 37: {region: 0x83, script: 0x70, flags: 0x2}, - 38: {region: 0xc4, script: 0x1e, flags: 0x0}, - 39: {region: 0x52, script: 0x66, flags: 0x4}, - 40: {region: 0x52, script: 0x66, flags: 0x2}, - 41: {region: 0xcf, script: 0x52, flags: 0x0}, - 42: {region: 0x49, script: 0x5, flags: 0x4}, - 43: {region: 0x94, script: 0x5, flags: 0x4}, - 44: {region: 0x98, script: 0x2f, flags: 0x0}, - 45: {region: 0xe7, script: 0x5, flags: 0x4}, - 46: {region: 0xe7, script: 0x5, flags: 0x2}, - 47: {region: 0x9b, script: 0x7c, flags: 0x0}, - 48: {region: 0x52, script: 0x7d, flags: 0x2}, - 49: {region: 0xb9, script: 0xd2, flags: 0x0}, - 50: {region: 0xd8, script: 0x52, flags: 0x4}, - 51: {region: 0xe7, script: 0x5, flags: 0x0}, - 52: {region: 0x98, script: 0x20, flags: 0x2}, - 53: {region: 0x98, script: 0x47, flags: 0x2}, - 54: {region: 0x98, script: 0xc0, flags: 0x2}, - 55: {region: 0x104, script: 0x1e, flags: 0x0}, - 56: {region: 0xbc, script: 0x52, flags: 0x4}, - 57: {region: 0x103, script: 0x52, flags: 0x4}, - 58: {region: 0x105, script: 0x52, flags: 0x4}, - 59: {region: 0x12a, script: 0x52, flags: 0x4}, - 60: {region: 0x123, script: 0x1e, flags: 0x0}, - 61: {region: 0xe7, script: 0x5, flags: 0x4}, - 62: {region: 0xe7, script: 0x5, flags: 0x2}, - 63: {region: 0x52, script: 0x5, flags: 0x0}, - 64: {region: 0xad, script: 0x1e, flags: 0x4}, - 65: {region: 0xc4, script: 0x1e, flags: 0x4}, - 66: {region: 0xad, script: 0x1e, flags: 0x2}, - 67: {region: 0x98, script: 0xe, flags: 0x0}, - 68: {region: 0xda, script: 0x20, flags: 0x4}, - 69: {region: 0xda, script: 0x20, flags: 0x2}, - 70: {region: 0x136, script: 0x52, flags: 0x0}, - 71: {region: 0x23, script: 0x5, flags: 0x4}, - 72: {region: 0x52, script: 0x1e, flags: 0x4}, - 73: {region: 0x23, script: 0x5, flags: 0x2}, - 74: {region: 0x8c, script: 0x35, flags: 0x0}, - 75: {region: 0x52, script: 0x34, flags: 0x4}, - 76: {region: 0x52, script: 0x34, flags: 0x2}, - 77: {region: 0x52, script: 0x34, flags: 0x0}, - 78: {region: 0x2e, script: 0x35, flags: 0x4}, - 79: {region: 0x3d, script: 0x35, flags: 0x4}, - 80: {region: 0x7a, script: 0x35, flags: 0x4}, - 81: {region: 0x7d, script: 0x35, flags: 0x4}, - 82: {region: 0x8c, script: 0x35, flags: 0x4}, - 83: {region: 0x94, script: 0x35, flags: 0x4}, - 84: {region: 0xc5, script: 0x35, flags: 0x4}, - 85: {region: 0xcf, script: 0x35, flags: 0x4}, - 86: {region: 0xe1, script: 0x35, flags: 0x4}, - 87: {region: 0xe4, script: 0x35, flags: 0x4}, - 88: {region: 0xe6, script: 0x35, flags: 0x4}, - 89: {region: 0x115, script: 0x35, flags: 0x4}, - 90: {region: 0x122, script: 0x35, flags: 0x4}, - 91: {region: 0x12d, script: 0x35, flags: 0x4}, - 92: {region: 0x134, script: 0x35, flags: 0x4}, - 93: {region: 0x13d, script: 0x35, flags: 0x4}, - 94: {region: 0x12d, script: 0x11, flags: 0x2}, - 95: {region: 0x12d, script: 0x30, flags: 0x2}, - 96: {region: 0x12d, script: 0x35, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 1428 bytes, 357 elements -var likelyRegion = [357]likelyLangScript{ - 33: {lang: 0xd7, script: 0x52, flags: 0x0}, - 34: {lang: 0x3a, script: 0x5, flags: 0x0}, - 35: {lang: 0x0, script: 0x2, flags: 0x1}, - 38: {lang: 0x2, script: 0x2, flags: 0x1}, - 39: {lang: 0x4, script: 0x2, flags: 0x1}, - 41: {lang: 0x3be, script: 0x52, flags: 0x0}, - 42: {lang: 0x0, script: 0x52, flags: 0x0}, - 43: {lang: 0x13d, script: 0x52, flags: 0x0}, - 44: {lang: 0x419, script: 0x52, flags: 0x0}, - 45: {lang: 0x10c, script: 0x52, flags: 0x0}, - 47: {lang: 0x365, script: 0x52, flags: 0x0}, - 48: {lang: 0x442, script: 0x52, flags: 0x0}, - 49: {lang: 0x58, script: 0x52, flags: 0x0}, - 50: {lang: 0x6, script: 0x2, flags: 0x1}, - 52: {lang: 0xa5, script: 0xe, flags: 0x0}, - 53: {lang: 0x365, script: 0x52, flags: 0x0}, - 54: {lang: 0x15d, script: 0x52, flags: 0x0}, - 55: {lang: 0x7e, script: 0x1e, flags: 0x0}, - 56: {lang: 0x3a, script: 0x5, flags: 0x0}, - 57: {lang: 0x3d7, script: 0x52, flags: 0x0}, - 58: {lang: 0x15d, script: 0x52, flags: 0x0}, - 59: {lang: 0x15d, script: 0x52, flags: 0x0}, - 61: {lang: 0x31d, script: 0x52, flags: 0x0}, - 62: {lang: 0x13d, script: 0x52, flags: 0x0}, - 63: {lang: 0x39f, script: 0x52, flags: 0x0}, - 64: {lang: 0x3be, script: 0x52, flags: 0x0}, - 66: {lang: 0x8, script: 0x2, flags: 0x1}, - 68: {lang: 0x0, script: 0x52, flags: 0x0}, - 70: {lang: 0x71, script: 0x1e, flags: 0x0}, - 72: {lang: 0x510, script: 0x37, flags: 0x2}, - 73: {lang: 0x31d, script: 0x5, flags: 0x2}, - 74: {lang: 0x443, script: 0x52, flags: 0x0}, - 75: {lang: 0x15d, script: 0x52, flags: 0x0}, - 76: {lang: 0x15d, script: 0x52, flags: 0x0}, - 77: {lang: 0x10c, script: 0x52, flags: 0x0}, - 78: {lang: 0x15d, script: 0x52, flags: 0x0}, - 80: {lang: 0x13d, script: 0x52, flags: 0x0}, - 81: {lang: 0x15d, script: 0x52, flags: 0x0}, - 82: {lang: 0xa, script: 0x5, flags: 0x1}, - 83: {lang: 0x13d, script: 0x52, flags: 0x0}, - 84: {lang: 0x0, script: 0x52, flags: 0x0}, - 85: {lang: 0x13d, script: 0x52, flags: 0x0}, - 88: {lang: 0x13d, script: 0x52, flags: 0x0}, - 89: {lang: 0x3be, script: 0x52, flags: 0x0}, - 90: {lang: 0x39f, script: 0x52, flags: 0x0}, - 92: {lang: 0xf, script: 0x2, flags: 0x1}, - 93: {lang: 0xf9, script: 0x52, flags: 0x0}, - 95: {lang: 0x10c, script: 0x52, flags: 0x0}, - 97: {lang: 0x1, script: 0x52, flags: 0x0}, - 98: {lang: 0x100, script: 0x52, flags: 0x0}, - 100: {lang: 0x13d, script: 0x52, flags: 0x0}, - 102: {lang: 0x11, script: 0x2, flags: 0x1}, - 103: {lang: 0x13d, script: 0x52, flags: 0x0}, - 104: {lang: 0x13d, script: 0x52, flags: 0x0}, - 105: {lang: 0x13f, script: 0x52, flags: 0x0}, - 106: {lang: 0x3a, script: 0x5, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, - 108: {lang: 0x46d, script: 0x27, flags: 0x0}, - 109: {lang: 0x13d, script: 0x52, flags: 0x0}, - 110: {lang: 0x13, script: 0x2, flags: 0x1}, - 112: {lang: 0x10c, script: 0x52, flags: 0x0}, - 113: {lang: 0x150, script: 0x52, flags: 0x0}, - 114: {lang: 0x1be, script: 0x20, flags: 0x2}, - 117: {lang: 0x157, script: 0x52, flags: 0x0}, - 119: {lang: 0x15d, script: 0x52, flags: 0x0}, - 121: {lang: 0x15d, script: 0x52, flags: 0x0}, - 122: {lang: 0x15, script: 0x2, flags: 0x1}, - 124: {lang: 0x17, script: 0x3, flags: 0x1}, - 125: {lang: 0x15d, script: 0x52, flags: 0x0}, - 127: {lang: 0x21, script: 0x52, flags: 0x0}, - 129: {lang: 0x243, script: 0x52, flags: 0x0}, - 131: {lang: 0x15d, script: 0x52, flags: 0x0}, - 132: {lang: 0x15d, script: 0x52, flags: 0x0}, - 133: {lang: 0x13d, script: 0x52, flags: 0x0}, - 134: {lang: 0x1a, script: 0x2, flags: 0x1}, - 135: {lang: 0x0, script: 0x52, flags: 0x0}, - 136: {lang: 0x13d, script: 0x52, flags: 0x0}, - 138: {lang: 0x3be, script: 0x52, flags: 0x0}, - 140: {lang: 0x527, script: 0x35, flags: 0x0}, - 141: {lang: 0x0, script: 0x52, flags: 0x0}, - 142: {lang: 0x13d, script: 0x52, flags: 0x0}, - 143: {lang: 0x1cf, script: 0x52, flags: 0x0}, - 144: {lang: 0x1d2, script: 0x52, flags: 0x0}, - 145: {lang: 0x1d3, script: 0x52, flags: 0x0}, - 147: {lang: 0x13d, script: 0x52, flags: 0x0}, - 148: {lang: 0x1c, script: 0x2, flags: 0x1}, - 150: {lang: 0x1ba, script: 0x37, flags: 0x0}, - 152: {lang: 0x1e, script: 0x3, flags: 0x1}, - 154: {lang: 0x3a, script: 0x5, flags: 0x0}, - 155: {lang: 0x21, script: 0x2, flags: 0x1}, - 156: {lang: 0x1f6, script: 0x52, flags: 0x0}, - 157: {lang: 0x1f7, script: 0x52, flags: 0x0}, - 160: {lang: 0x3a, script: 0x5, flags: 0x0}, - 161: {lang: 0x1fe, script: 0x41, flags: 0x0}, - 163: {lang: 0x443, script: 0x52, flags: 0x0}, - 164: {lang: 0x288, script: 0x1e, flags: 0x0}, - 165: {lang: 0x23, script: 0x3, flags: 0x1}, - 167: {lang: 0x26, script: 0x2, flags: 0x1}, - 169: {lang: 0x252, script: 0x4b, flags: 0x0}, - 170: {lang: 0x252, script: 0x4b, flags: 0x0}, - 171: {lang: 0x3a, script: 0x5, flags: 0x0}, - 173: {lang: 0x3e0, script: 0x1e, flags: 0x0}, - 174: {lang: 0x28, script: 0x2, flags: 0x1}, - 175: {lang: 0x3a, script: 0x5, flags: 0x0}, - 177: {lang: 0x10c, script: 0x52, flags: 0x0}, - 178: {lang: 0x40a, script: 0xc1, flags: 0x0}, - 180: {lang: 0x439, script: 0x52, flags: 0x0}, - 181: {lang: 0x2be, script: 0x52, flags: 0x0}, - 182: {lang: 0x15d, script: 0x52, flags: 0x0}, - 183: {lang: 0x2c5, script: 0x52, flags: 0x0}, - 184: {lang: 0x3a, script: 0x5, flags: 0x0}, - 185: {lang: 0x2a, script: 0x2, flags: 0x1}, - 186: {lang: 0x15d, script: 0x52, flags: 0x0}, - 187: {lang: 0x2c, script: 0x2, flags: 0x1}, - 188: {lang: 0x430, script: 0x52, flags: 0x0}, - 189: {lang: 0x15d, script: 0x52, flags: 0x0}, - 190: {lang: 0x2ef, script: 0x52, flags: 0x0}, - 193: {lang: 0x2e, script: 0x2, flags: 0x1}, - 194: {lang: 0xa0, script: 0x52, flags: 0x0}, - 195: {lang: 0x30, script: 0x2, flags: 0x1}, - 196: {lang: 0x32, script: 0x2, flags: 0x1}, - 197: {lang: 0x34, script: 0x2, flags: 0x1}, - 199: {lang: 0x15d, script: 0x52, flags: 0x0}, - 200: {lang: 0x36, script: 0x2, flags: 0x1}, - 202: {lang: 0x31e, script: 0x52, flags: 0x0}, - 203: {lang: 0x38, script: 0x3, flags: 0x1}, - 204: {lang: 0x127, script: 0xd4, flags: 0x0}, - 206: {lang: 0x13d, script: 0x52, flags: 0x0}, - 207: {lang: 0x31d, script: 0x52, flags: 0x0}, - 208: {lang: 0x3be, script: 0x52, flags: 0x0}, - 209: {lang: 0x16, script: 0x52, flags: 0x0}, - 210: {lang: 0x15d, script: 0x52, flags: 0x0}, - 211: {lang: 0x1b2, script: 0x52, flags: 0x0}, - 213: {lang: 0x1b2, script: 0x5, flags: 0x2}, - 215: {lang: 0x13d, script: 0x52, flags: 0x0}, - 216: {lang: 0x365, script: 0x52, flags: 0x0}, - 217: {lang: 0x345, script: 0x52, flags: 0x0}, - 218: {lang: 0x34f, script: 0x20, flags: 0x0}, - 224: {lang: 0x3a, script: 0x5, flags: 0x0}, - 225: {lang: 0x13d, script: 0x52, flags: 0x0}, - 227: {lang: 0x13d, script: 0x52, flags: 0x0}, - 228: {lang: 0x15d, script: 0x52, flags: 0x0}, - 229: {lang: 0x484, script: 0x52, flags: 0x0}, - 230: {lang: 0x152, script: 0x52, flags: 0x0}, - 231: {lang: 0x3b, script: 0x3, flags: 0x1}, - 232: {lang: 0x3b1, script: 0x52, flags: 0x0}, - 233: {lang: 0x15d, script: 0x52, flags: 0x0}, - 235: {lang: 0x13d, script: 0x52, flags: 0x0}, - 236: {lang: 0x3a, script: 0x5, flags: 0x0}, - 237: {lang: 0x3be, script: 0x52, flags: 0x0}, - 239: {lang: 0x3a0, script: 0x52, flags: 0x0}, - 240: {lang: 0x192, script: 0x52, flags: 0x0}, - 242: {lang: 0x3a, script: 0x5, flags: 0x0}, - 257: {lang: 0x15d, script: 0x52, flags: 0x0}, - 259: {lang: 0x3e, script: 0x2, flags: 0x1}, - 260: {lang: 0x430, script: 0x1e, flags: 0x0}, - 261: {lang: 0x40, script: 0x2, flags: 0x1}, - 262: {lang: 0x3e3, script: 0x52, flags: 0x0}, - 263: {lang: 0x3a, script: 0x5, flags: 0x0}, - 265: {lang: 0x15d, script: 0x52, flags: 0x0}, - 266: {lang: 0x3a, script: 0x5, flags: 0x0}, - 267: {lang: 0x42, script: 0x2, flags: 0x1}, - 270: {lang: 0x414, script: 0x52, flags: 0x0}, - 271: {lang: 0x345, script: 0x52, flags: 0x0}, - 272: {lang: 0x44, script: 0x2, flags: 0x1}, - 274: {lang: 0x1f7, script: 0x52, flags: 0x0}, - 275: {lang: 0x15d, script: 0x52, flags: 0x0}, - 276: {lang: 0x427, script: 0x52, flags: 0x0}, - 277: {lang: 0x365, script: 0x52, flags: 0x0}, - 279: {lang: 0x3be, script: 0x52, flags: 0x0}, - 281: {lang: 0x13d, script: 0x52, flags: 0x0}, - 283: {lang: 0x46, script: 0x2, flags: 0x1}, - 287: {lang: 0x15d, script: 0x52, flags: 0x0}, - 288: {lang: 0x15d, script: 0x52, flags: 0x0}, - 289: {lang: 0x48, script: 0x2, flags: 0x1}, - 290: {lang: 0x4a, script: 0x3, flags: 0x1}, - 291: {lang: 0x4d, script: 0x2, flags: 0x1}, - 292: {lang: 0x475, script: 0x52, flags: 0x0}, - 293: {lang: 0x3be, script: 0x52, flags: 0x0}, - 294: {lang: 0x474, script: 0x52, flags: 0x0}, - 295: {lang: 0x4f, script: 0x2, flags: 0x1}, - 296: {lang: 0x480, script: 0x52, flags: 0x0}, - 298: {lang: 0x51, script: 0x4, flags: 0x1}, - 300: {lang: 0x49e, script: 0x52, flags: 0x0}, - 301: {lang: 0x55, script: 0x2, flags: 0x1}, - 302: {lang: 0x443, script: 0x52, flags: 0x0}, - 303: {lang: 0x57, script: 0x3, flags: 0x1}, - 304: {lang: 0x443, script: 0x52, flags: 0x0}, - 308: {lang: 0x510, script: 0x37, flags: 0x2}, - 309: {lang: 0x13d, script: 0x52, flags: 0x0}, - 310: {lang: 0x4ba, script: 0x52, flags: 0x0}, - 311: {lang: 0x1f7, script: 0x52, flags: 0x0}, - 314: {lang: 0x13d, script: 0x52, flags: 0x0}, - 317: {lang: 0x4c1, script: 0x52, flags: 0x0}, - 318: {lang: 0x8a, script: 0x52, flags: 0x0}, - 319: {lang: 0x15d, script: 0x52, flags: 0x0}, - 321: {lang: 0x419, script: 0x52, flags: 0x0}, - 332: {lang: 0x5a, script: 0x2, flags: 0x1}, - 349: {lang: 0x3a, script: 0x5, flags: 0x0}, - 350: {lang: 0x5c, script: 0x2, flags: 0x1}, - 355: {lang: 0x421, script: 0x52, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 376 bytes, 94 elements -var likelyRegionList = [94]likelyLangScript{ - 0: {lang: 0x147, script: 0x5, flags: 0x0}, - 1: {lang: 0x474, script: 0x52, flags: 0x0}, - 2: {lang: 0x42f, script: 0x52, flags: 0x0}, - 3: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 4: {lang: 0x1d5, script: 0x8, flags: 0x0}, - 5: {lang: 0x272, script: 0x52, flags: 0x0}, - 6: {lang: 0xb7, script: 0x52, flags: 0x0}, - 7: {lang: 0x430, script: 0x1e, flags: 0x0}, - 8: {lang: 0x12c, script: 0xd6, flags: 0x0}, - 9: {lang: 0x34f, script: 0x20, flags: 0x0}, - 10: {lang: 0x527, script: 0x34, flags: 0x0}, - 11: {lang: 0x4aa, script: 0x5, flags: 0x0}, - 12: {lang: 0x51d, script: 0x35, flags: 0x0}, - 13: {lang: 0x521, script: 0x52, flags: 0x0}, - 14: {lang: 0x298, script: 0xd5, flags: 0x0}, - 15: {lang: 0x135, script: 0x2d, flags: 0x0}, - 16: {lang: 0x488, script: 0x52, flags: 0x0}, - 17: {lang: 0x3a, script: 0x5, flags: 0x0}, - 18: {lang: 0x15d, script: 0x52, flags: 0x0}, - 19: {lang: 0x27, script: 0x27, flags: 0x0}, - 20: {lang: 0x138, script: 0x52, flags: 0x0}, - 21: {lang: 0x268, script: 0x5, flags: 0x2}, - 22: {lang: 0x510, script: 0x37, flags: 0x2}, - 23: {lang: 0x20e, script: 0x29, flags: 0x0}, - 24: {lang: 0x5, script: 0x1e, flags: 0x0}, - 25: {lang: 0x272, script: 0x52, flags: 0x0}, - 26: {lang: 0x135, script: 0x2d, flags: 0x0}, - 27: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 28: {lang: 0x1df, script: 0x52, flags: 0x0}, - 29: {lang: 0x31d, script: 0x5, flags: 0x0}, - 30: {lang: 0x1bc, script: 0x20, flags: 0x0}, - 31: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 32: {lang: 0x234, script: 0x6b, flags: 0x0}, - 33: {lang: 0x147, script: 0x5, flags: 0x0}, - 34: {lang: 0x474, script: 0x52, flags: 0x0}, - 35: {lang: 0x248, script: 0x46, flags: 0x0}, - 36: {lang: 0xe6, script: 0x5, flags: 0x0}, - 37: {lang: 0x224, script: 0xd5, flags: 0x0}, - 38: {lang: 0x3a, script: 0x5, flags: 0x0}, - 39: {lang: 0x15d, script: 0x52, flags: 0x0}, - 40: {lang: 0x2b6, script: 0x4f, flags: 0x0}, - 41: {lang: 0x224, script: 0xd5, flags: 0x0}, - 42: {lang: 0x3a, script: 0x5, flags: 0x0}, - 43: {lang: 0x15d, script: 0x52, flags: 0x0}, - 44: {lang: 0x3da, script: 0x52, flags: 0x0}, - 45: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 46: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 47: {lang: 0x42f, script: 0x52, flags: 0x0}, - 48: {lang: 0x32f, script: 0x6b, flags: 0x0}, - 49: {lang: 0x211, script: 0x52, flags: 0x0}, - 50: {lang: 0x309, script: 0x1e, flags: 0x0}, - 51: {lang: 0x240, script: 0x5, flags: 0x0}, - 52: {lang: 0x527, script: 0x35, flags: 0x0}, - 53: {lang: 0x3be, script: 0x52, flags: 0x0}, - 54: {lang: 0x3a, script: 0x5, flags: 0x0}, - 55: {lang: 0x15d, script: 0x52, flags: 0x0}, - 56: {lang: 0x2eb, script: 0x52, flags: 0x0}, - 57: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 58: {lang: 0x88, script: 0x20, flags: 0x0}, - 59: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 60: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 61: {lang: 0xbe, script: 0x20, flags: 0x0}, - 62: {lang: 0x3da, script: 0x52, flags: 0x0}, - 63: {lang: 0x7e, script: 0x1e, flags: 0x0}, - 64: {lang: 0x3e0, script: 0x1e, flags: 0x0}, - 65: {lang: 0x265, script: 0x52, flags: 0x0}, - 66: {lang: 0x442, script: 0x52, flags: 0x0}, - 67: {lang: 0x510, script: 0x37, flags: 0x0}, - 68: {lang: 0x410, script: 0x52, flags: 0x0}, - 69: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 70: {lang: 0x3a, script: 0x5, flags: 0x0}, - 71: {lang: 0x15d, script: 0x52, flags: 0x0}, - 72: {lang: 0x15d, script: 0x52, flags: 0x0}, - 73: {lang: 0x35, script: 0x5, flags: 0x0}, - 74: {lang: 0x469, script: 0xd5, flags: 0x0}, - 75: {lang: 0x2ea, script: 0x5, flags: 0x0}, - 76: {lang: 0x30d, script: 0x6b, flags: 0x0}, - 77: {lang: 0x465, script: 0x1e, flags: 0x0}, - 78: {lang: 0x147, script: 0x5, flags: 0x0}, - 79: {lang: 0x3a, script: 0x5, flags: 0x0}, - 80: {lang: 0x15d, script: 0x52, flags: 0x0}, - 81: {lang: 0x488, script: 0x52, flags: 0x0}, - 82: {lang: 0x58, script: 0x5, flags: 0x0}, - 83: {lang: 0x217, script: 0x1e, flags: 0x0}, - 84: {lang: 0x81, script: 0x2d, flags: 0x0}, - 85: {lang: 0x527, script: 0x35, flags: 0x0}, - 86: {lang: 0x48a, script: 0x52, flags: 0x0}, - 87: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 88: {lang: 0x510, script: 0x37, flags: 0x0}, - 89: {lang: 0x3b1, script: 0x52, flags: 0x0}, - 90: {lang: 0x42f, script: 0x52, flags: 0x0}, - 91: {lang: 0x430, script: 0x1e, flags: 0x0}, - 92: {lang: 0x15d, script: 0x52, flags: 0x0}, - 93: {lang: 0x444, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint8 -} - -// Size: 192 bytes, 32 elements -var likelyRegionGroup = [32]likelyTag{ - 1: {lang: 0x138, region: 0xd5, script: 0x52}, - 2: {lang: 0x138, region: 0x134, script: 0x52}, - 3: {lang: 0x3be, region: 0x40, script: 0x52}, - 4: {lang: 0x138, region: 0x2e, script: 0x52}, - 5: {lang: 0x138, region: 0xd5, script: 0x52}, - 6: {lang: 0x13d, region: 0xce, script: 0x52}, - 7: {lang: 0x443, region: 0x12e, script: 0x52}, - 8: {lang: 0x3a, region: 0x6a, script: 0x5}, - 9: {lang: 0x443, region: 0x4a, script: 0x52}, - 10: {lang: 0x138, region: 0x160, script: 0x52}, - 11: {lang: 0x138, region: 0x134, script: 0x52}, - 12: {lang: 0x138, region: 0x134, script: 0x52}, - 13: {lang: 0x13d, region: 0x58, script: 0x52}, - 14: {lang: 0x527, region: 0x52, script: 0x34}, - 15: {lang: 0x1bc, region: 0x98, script: 0x20}, - 16: {lang: 0x1df, region: 0x94, script: 0x52}, - 17: {lang: 0x1f7, region: 0x9d, script: 0x52}, - 18: {lang: 0x138, region: 0x2e, script: 0x52}, - 19: {lang: 0x138, region: 0xe5, script: 0x52}, - 20: {lang: 0x138, region: 0x89, script: 0x52}, - 21: {lang: 0x419, region: 0x141, script: 0x52}, - 22: {lang: 0x527, region: 0x52, script: 0x34}, - 23: {lang: 0x4ba, region: 0x136, script: 0x52}, - 24: {lang: 0x3a, region: 0x107, script: 0x5}, - 25: {lang: 0x3e0, region: 0x105, script: 0x1e}, - 26: {lang: 0x3e0, region: 0x105, script: 0x1e}, - 27: {lang: 0x138, region: 0x7a, script: 0x52}, - 28: {lang: 0x10c, region: 0x5f, script: 0x52}, - 29: {lang: 0x13d, region: 0x1e, script: 0x52}, - 30: {lang: 0x138, region: 0x99, script: 0x52}, - 31: {lang: 0x138, region: 0x7a, script: 0x52}, -} - -// Size: 357 bytes, 357 elements -var regionToGroups = [357]uint8{ +var regionToGroups = []uint8{ // 357 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, 0x04, - // Entry 40 - 7F - 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, - 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, 0x00, - 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, - // Entry 80 - BF - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x01, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, 0x04, - 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, + 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + // Entry C0 - FF + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, + 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, 0x00, - 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} +} // Size: 381 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7b}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xee}, +} // Size: 42 bytes type mutualIntelligibility struct { want uint16 @@ -3330,7 +113,6 @@ type mutualIntelligibility struct { distance uint8 oneway bool } - type scriptIntelligibility struct { wantLang uint16 haveLang uint16 @@ -3338,7 +120,6 @@ type scriptIntelligibility struct { haveScript uint8 distance uint8 } - type regionIntelligibility struct { lang uint16 script uint8 @@ -3349,306 +130,169 @@ type regionIntelligibility struct { // matchLang holds pairs of langIDs of base languages that are typically // mutually intelligible. Each pair is associated with a confidence and // whether the intelligibility goes one or both ways. -// Size: 690 bytes, 115 elements -var matchLang = [115]mutualIntelligibility{ - 0: {want: 0x1cf, have: 0xb7, distance: 0x4, oneway: false}, - 1: {want: 0x405, have: 0xb7, distance: 0x4, oneway: false}, - 2: {want: 0x405, have: 0x1cf, distance: 0x4, oneway: false}, - 3: {want: 0x405, have: 0x430, distance: 0x4, oneway: false}, - 4: {want: 0x438, have: 0x1, distance: 0x4, oneway: false}, - 5: {want: 0x1a1, have: 0x10c, distance: 0x4, oneway: true}, - 6: {want: 0x293, have: 0x10c, distance: 0x4, oneway: true}, - 7: {want: 0x430, have: 0x1cf, distance: 0x5, oneway: false}, - 8: {want: 0x430, have: 0xb7, distance: 0x5, oneway: false}, - 9: {want: 0x100, have: 0x36d, distance: 0x8, oneway: false}, - 10: {want: 0x100, have: 0x345, distance: 0x8, oneway: false}, - 11: {want: 0x5, have: 0x3e0, distance: 0xa, oneway: true}, - 12: {want: 0xd, have: 0x138, distance: 0xa, oneway: true}, - 13: {want: 0x16, have: 0x365, distance: 0xa, oneway: true}, - 14: {want: 0x21, have: 0x138, distance: 0xa, oneway: true}, - 15: {want: 0x56, have: 0x13d, distance: 0xa, oneway: true}, - 16: {want: 0x58, have: 0x3e0, distance: 0xa, oneway: true}, - 17: {want: 0x71, have: 0x3e0, distance: 0xa, oneway: true}, - 18: {want: 0x75, have: 0x138, distance: 0xa, oneway: true}, - 19: {want: 0x82, have: 0x1bc, distance: 0xa, oneway: true}, - 20: {want: 0xa5, have: 0x138, distance: 0xa, oneway: true}, - 21: {want: 0xb2, have: 0x15d, distance: 0xa, oneway: true}, - 22: {want: 0xdd, have: 0x152, distance: 0xa, oneway: true}, - 23: {want: 0xe5, have: 0x138, distance: 0xa, oneway: true}, - 24: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, - 25: {want: 0xef, have: 0x15d, distance: 0xa, oneway: true}, - 26: {want: 0xf8, have: 0x15d, distance: 0xa, oneway: true}, - 27: {want: 0xff, have: 0x138, distance: 0xa, oneway: true}, - 28: {want: 0x12f, have: 0x138, distance: 0xa, oneway: true}, - 29: {want: 0x13b, have: 0x138, distance: 0xa, oneway: true}, - 30: {want: 0x13f, have: 0x150, distance: 0xa, oneway: true}, - 31: {want: 0x144, have: 0x13d, distance: 0xa, oneway: true}, - 32: {want: 0x157, have: 0x100, distance: 0xa, oneway: true}, - 33: {want: 0x16c, have: 0x365, distance: 0xa, oneway: true}, - 34: {want: 0x16d, have: 0x138, distance: 0xa, oneway: true}, - 35: {want: 0x16e, have: 0x138, distance: 0xa, oneway: true}, - 36: {want: 0x17c, have: 0x138, distance: 0xa, oneway: true}, - 37: {want: 0x18e, have: 0x13d, distance: 0xa, oneway: true}, - 38: {want: 0x192, have: 0x13d, distance: 0xa, oneway: true}, - 39: {want: 0x1a2, have: 0x1bc, distance: 0xa, oneway: true}, - 40: {want: 0x1b2, have: 0x138, distance: 0xa, oneway: true}, - 41: {want: 0x1b6, have: 0x138, distance: 0xa, oneway: true}, - 42: {want: 0x1d2, have: 0x15d, distance: 0xa, oneway: true}, - 43: {want: 0x1d5, have: 0x3e0, distance: 0xa, oneway: true}, - 44: {want: 0x1d7, have: 0x138, distance: 0xa, oneway: true}, - 45: {want: 0x1e5, have: 0x138, distance: 0xa, oneway: true}, - 46: {want: 0x1f6, have: 0x138, distance: 0xa, oneway: true}, - 47: {want: 0x20c, have: 0x1df, distance: 0xa, oneway: true}, - 48: {want: 0x20e, have: 0x138, distance: 0xa, oneway: true}, - 49: {want: 0x22b, have: 0x15d, distance: 0xa, oneway: true}, - 50: {want: 0x240, have: 0x3e0, distance: 0xa, oneway: true}, - 51: {want: 0x248, have: 0x138, distance: 0xa, oneway: true}, - 52: {want: 0x24f, have: 0x138, distance: 0xa, oneway: true}, - 53: {want: 0x263, have: 0x138, distance: 0xa, oneway: true}, - 54: {want: 0x272, have: 0x488, distance: 0xa, oneway: true}, - 55: {want: 0x288, have: 0x3e0, distance: 0xa, oneway: true}, - 56: {want: 0x28c, have: 0x1f7, distance: 0xa, oneway: true}, - 57: {want: 0x2a1, have: 0x138, distance: 0xa, oneway: true}, - 58: {want: 0x2b3, have: 0x15d, distance: 0xa, oneway: true}, - 59: {want: 0x2b6, have: 0x138, distance: 0xa, oneway: true}, - 60: {want: 0x2bc, have: 0x138, distance: 0xa, oneway: true}, - 61: {want: 0x2c1, have: 0x15d, distance: 0xa, oneway: true}, - 62: {want: 0x2eb, have: 0x138, distance: 0xa, oneway: true}, - 63: {want: 0x2ef, have: 0x15d, distance: 0xa, oneway: true}, - 64: {want: 0x2f8, have: 0x138, distance: 0xa, oneway: true}, - 65: {want: 0x2fd, have: 0x7e, distance: 0xa, oneway: true}, - 66: {want: 0x302, have: 0x138, distance: 0xa, oneway: true}, - 67: {want: 0x309, have: 0x3e0, distance: 0xa, oneway: true}, - 68: {want: 0x319, have: 0x1bc, distance: 0xa, oneway: true}, - 69: {want: 0x31d, have: 0x1df, distance: 0xa, oneway: true}, - 70: {want: 0x31e, have: 0x138, distance: 0xa, oneway: true}, - 71: {want: 0x32f, have: 0x138, distance: 0xa, oneway: true}, - 72: {want: 0x34f, have: 0x138, distance: 0xa, oneway: true}, - 73: {want: 0x368, have: 0x345, distance: 0xa, oneway: false}, - 74: {want: 0x368, have: 0x36d, distance: 0xa, oneway: true}, - 75: {want: 0x378, have: 0x138, distance: 0xa, oneway: true}, - 76: {want: 0x385, have: 0x138, distance: 0xa, oneway: true}, - 77: {want: 0x387, have: 0x138, distance: 0xa, oneway: true}, - 78: {want: 0x389, have: 0x15d, distance: 0xa, oneway: true}, - 79: {want: 0x38e, have: 0x138, distance: 0xa, oneway: true}, - 80: {want: 0x393, have: 0x138, distance: 0xa, oneway: true}, - 81: {want: 0x39b, have: 0x138, distance: 0xa, oneway: true}, - 82: {want: 0x3a3, have: 0x138, distance: 0xa, oneway: true}, - 83: {want: 0x3bc, have: 0x138, distance: 0xa, oneway: true}, - 84: {want: 0x3c2, have: 0x13d, distance: 0xa, oneway: true}, - 85: {want: 0x3d2, have: 0x10c, distance: 0xa, oneway: true}, - 86: {want: 0x3d7, have: 0x138, distance: 0xa, oneway: true}, - 87: {want: 0x3e3, have: 0x15d, distance: 0xa, oneway: true}, - 88: {want: 0x3e7, have: 0x1bc, distance: 0xa, oneway: true}, - 89: {want: 0x3f8, have: 0x138, distance: 0xa, oneway: true}, - 90: {want: 0x40a, have: 0x138, distance: 0xa, oneway: true}, - 91: {want: 0x421, have: 0x138, distance: 0xa, oneway: true}, - 92: {want: 0x427, have: 0x138, distance: 0xa, oneway: true}, - 93: {want: 0x42f, have: 0x138, distance: 0xa, oneway: true}, - 94: {want: 0x439, have: 0x138, distance: 0xa, oneway: true}, - 95: {want: 0x43c, have: 0x1df, distance: 0xa, oneway: true}, - 96: {want: 0x443, have: 0x138, distance: 0xa, oneway: true}, - 97: {want: 0x44e, have: 0x138, distance: 0xa, oneway: true}, - 98: {want: 0x45f, have: 0x138, distance: 0xa, oneway: true}, - 99: {want: 0x465, have: 0x3e0, distance: 0xa, oneway: true}, - 100: {want: 0x46d, have: 0x138, distance: 0xa, oneway: true}, - 101: {want: 0x474, have: 0x3e0, distance: 0xa, oneway: true}, - 102: {want: 0x3880, have: 0x138, distance: 0xa, oneway: true}, - 103: {want: 0x47e, have: 0x138, distance: 0xa, oneway: true}, - 104: {want: 0x480, have: 0x138, distance: 0xa, oneway: true}, - 105: {want: 0x492, have: 0x3e0, distance: 0xa, oneway: true}, - 106: {want: 0x49b, have: 0x138, distance: 0xa, oneway: true}, - 107: {want: 0x4aa, have: 0x527, distance: 0xa, oneway: true}, - 108: {want: 0x4b2, have: 0x138, distance: 0xa, oneway: true}, - 109: {want: 0x4ba, have: 0x3e0, distance: 0xa, oneway: true}, - 110: {want: 0x4e3, have: 0x15d, distance: 0xa, oneway: true}, - 111: {want: 0x4f0, have: 0x138, distance: 0xa, oneway: true}, - 112: {want: 0x510, have: 0x138, distance: 0xa, oneway: true}, - 113: {want: 0x516, have: 0x138, distance: 0xa, oneway: true}, - 114: {want: 0x52c, have: 0x138, distance: 0xa, oneway: true}, -} +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. -// Size: 208 bytes, 26 elements -var matchScript = [26]scriptIntelligibility{ - 0: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x52, haveScript: 0x1e, distance: 0x5}, - 1: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x1e, haveScript: 0x52, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x138, wantScript: 0xe, haveScript: 0x52, distance: 0xa}, - 4: {wantLang: 0x1d5, haveLang: 0x3e0, wantScript: 0x8, haveScript: 0x1e, distance: 0xa}, - 5: {wantLang: 0x20e, haveLang: 0x138, wantScript: 0x29, haveScript: 0x52, distance: 0xa}, - 6: {wantLang: 0x248, haveLang: 0x138, wantScript: 0x46, haveScript: 0x52, distance: 0xa}, - 7: {wantLang: 0x24f, haveLang: 0x138, wantScript: 0x4a, haveScript: 0x52, distance: 0xa}, - 8: {wantLang: 0x2b6, haveLang: 0x138, wantScript: 0x4f, haveScript: 0x52, distance: 0xa}, - 9: {wantLang: 0x302, haveLang: 0x138, wantScript: 0x64, haveScript: 0x52, distance: 0xa}, - 10: {wantLang: 0x32f, haveLang: 0x138, wantScript: 0x6b, haveScript: 0x52, distance: 0xa}, - 11: {wantLang: 0x34f, haveLang: 0x138, wantScript: 0x20, haveScript: 0x52, distance: 0xa}, - 12: {wantLang: 0x393, haveLang: 0x138, wantScript: 0x75, haveScript: 0x52, distance: 0xa}, - 13: {wantLang: 0x39b, haveLang: 0x138, wantScript: 0x2f, haveScript: 0x52, distance: 0xa}, - 14: {wantLang: 0x3bc, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, - 15: {wantLang: 0x3f8, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, - 16: {wantLang: 0x40a, haveLang: 0x138, wantScript: 0xc1, haveScript: 0x52, distance: 0xa}, - 17: {wantLang: 0x44e, haveLang: 0x138, wantScript: 0xcd, haveScript: 0x52, distance: 0xa}, - 18: {wantLang: 0x45f, haveLang: 0x138, wantScript: 0xd0, haveScript: 0x52, distance: 0xa}, - 19: {wantLang: 0x46d, haveLang: 0x138, wantScript: 0x27, haveScript: 0x52, distance: 0xa}, - 20: {wantLang: 0x474, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, - 21: {wantLang: 0x4b2, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, - 22: {wantLang: 0x4ba, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, - 23: {wantLang: 0x510, haveLang: 0x138, wantScript: 0x37, haveScript: 0x52, distance: 0xa}, - 24: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x34, haveScript: 0x35, distance: 0xf}, - 25: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x35, haveScript: 0x34, distance: 0x13}, -} +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x57, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x1f, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2b, haveScript: 0x57, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4b, haveScript: 0x57, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x57, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x54, haveScript: 0x57, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6b, haveScript: 0x57, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x72, haveScript: 0x57, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x21, haveScript: 0x57, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x7d, haveScript: 0x57, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x33, haveScript: 0x57, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xca, haveScript: 0x57, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xd7, haveScript: 0x57, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xda, haveScript: 0x57, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x29, haveScript: 0x57, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13}, +} // Size: 232 bytes -// Size: 90 bytes, 15 elements -var matchRegion = [15]regionIntelligibility{ +var matchRegion = []regionIntelligibility{ // 15 elements 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, - 2: {lang: 0x138, script: 0x0, group: 0x1, distance: 0x4}, - 3: {lang: 0x138, script: 0x0, group: 0x81, distance: 0x4}, - 4: {lang: 0x13d, script: 0x0, group: 0x3, distance: 0x4}, - 5: {lang: 0x13d, script: 0x0, group: 0x83, distance: 0x4}, - 6: {lang: 0x3be, script: 0x0, group: 0x3, distance: 0x4}, - 7: {lang: 0x3be, script: 0x0, group: 0x83, distance: 0x4}, - 8: {lang: 0x527, script: 0x35, group: 0x2, distance: 0x4}, - 9: {lang: 0x527, script: 0x35, group: 0x82, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x39, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x39, group: 0x82, distance: 0x4}, 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, - 11: {lang: 0x138, script: 0x0, group: 0x80, distance: 0x5}, - 12: {lang: 0x13d, script: 0x0, group: 0x80, distance: 0x5}, - 13: {lang: 0x3be, script: 0x0, group: 0x80, distance: 0x5}, - 14: {lang: 0x527, script: 0x35, group: 0x80, distance: 0x5}, -} + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5}, +} // Size: 114 bytes -// Size: 128 bytes, 32 elements -var regionContainment = [32]uint32{ - 0xffffffff, 0x000007a2, 0x00003044, 0x00000008, - 0x403c0010, 0x00000020, 0x00000040, 0x00000080, - 0x00000100, 0x00000200, 0x00000400, 0x2000384c, - 0x00001000, 0x00002000, 0x00004000, 0x00008000, - 0x00010000, 0x00020000, 0x00040000, 0x00080000, - 0x00100000, 0x00200000, 0x01c1c000, 0x00800000, - 0x01000000, 0x1e020000, 0x04000000, 0x08000000, - 0x10000000, 0x20002048, 0x40000000, 0x80000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 357 bytes, 357 elements -var regionInclusion = [357]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x20, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x25, 0x22, 0x23, - 0x25, 0x26, 0x21, 0x27, 0x28, 0x29, 0x2a, 0x25, - 0x2b, 0x23, 0x22, 0x25, 0x24, 0x29, 0x2c, 0x2d, - 0x23, 0x2e, 0x2c, 0x25, 0x2f, 0x30, 0x27, 0x25, - // Entry 40 - 7F - 0x27, 0x25, 0x24, 0x30, 0x21, 0x31, 0x32, 0x33, - 0x2f, 0x21, 0x26, 0x26, 0x26, 0x34, 0x2c, 0x28, - 0x27, 0x26, 0x35, 0x27, 0x21, 0x33, 0x22, 0x20, - 0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29, - 0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38, - 0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f, - 0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, - 0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, - // Entry 80 - BF - 0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, - 0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, - 0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, - 0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, - 0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, - 0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, - 0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, - 0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, - // Entry C0 - FF - 0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, - 0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, - 0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, - 0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, - 0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, - 0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, - 0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - // Entry 100 - 13F - 0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, - 0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, - 0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26, - 0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, - 0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, - 0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, - 0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22, - 0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, - // Entry 140 - 17F - 0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, - 0x31, 0x2e, 0x26, 0x2e, 0x20, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 288 bytes, 72 elements -var regionInclusionBits = [72]uint32{ - // Entry 0 - 1F - 0x82400813, 0x000007a3, 0x00003844, 0x20000808, - 0x403c0011, 0x00000022, 0x20000844, 0x00000082, - 0x00000102, 0x00000202, 0x00000402, 0x2000384d, - 0x00001804, 0x20002804, 0x00404000, 0x00408000, - 0x00410000, 0x02020000, 0x00040010, 0x00080010, - 0x00100010, 0x00200010, 0x01c1c001, 0x00c00000, - 0x01400000, 0x1e020001, 0x06000000, 0x0a000000, - 0x12000000, 0x20002848, 0x40000010, 0x80000001, - // Entry 20 - 3F - 0x00000001, 0x40000000, 0x00020000, 0x01000000, - 0x00008000, 0x00002000, 0x00000200, 0x00000008, - 0x00200000, 0x90000000, 0x00040000, 0x08000000, - 0x00000020, 0x84000000, 0x00000080, 0x00001000, - 0x00010000, 0x00000400, 0x04000000, 0x00000040, - 0x10000000, 0x00004000, 0x81000000, 0x88000000, - 0x00000100, 0x80020000, 0x00080000, 0x00100000, - 0x00800000, 0xffffffff, 0x82400fb3, 0xc27c0813, - // Entry 40 - 5F - 0xa240385f, 0x83c1c813, 0x9e420813, 0x92000001, - 0x86000001, 0x81400001, 0x8a000001, 0x82020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 72 bytes, 72 elements -var regionInclusionNext = [72]uint8{ - // Entry 0 - 3F - 0x3d, 0x3e, 0x0b, 0x0b, 0x3f, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x40, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x41, 0x16, - 0x16, 0x42, 0x19, 0x19, 0x19, 0x0b, 0x04, 0x00, - 0x00, 0x1e, 0x11, 0x18, 0x0f, 0x0d, 0x09, 0x03, - 0x15, 0x43, 0x12, 0x1b, 0x05, 0x44, 0x07, 0x0c, - 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x45, 0x46, - 0x08, 0x47, 0x13, 0x14, 0x17, 0x3d, 0x3d, 0x3d, - // Entry 40 - 7F - 0x3d, 0x3d, 0x3d, 0x42, 0x42, 0x41, 0x42, 0x42, -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}}, - 1: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}}, - 2: {lang: 0x13d, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x47, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}}, - 3: {lang: 0x3be, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}}, - 4: {lang: 0x527, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}}, -} - -// Total table size 26496 bytes (25KiB); checksum: 6E24B15A +// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go index de30155a26..42ea792666 100644 --- a/vendor/golang.org/x/text/language/tags.go +++ b/vendor/golang.org/x/text/language/tags.go @@ -4,6 +4,8 @@ package language +import "golang.org/x/text/internal/language/compact" + // TODO: Various sets of commonly use tags and regions. // MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. @@ -61,83 +63,83 @@ var ( Und Tag = Tag{} - Afrikaans Tag = Tag{lang: _af} // af - Amharic Tag = Tag{lang: _am} // am - Arabic Tag = Tag{lang: _ar} // ar - ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001 - Azerbaijani Tag = Tag{lang: _az} // az - Bulgarian Tag = Tag{lang: _bg} // bg - Bengali Tag = Tag{lang: _bn} // bn - Catalan Tag = Tag{lang: _ca} // ca - Czech Tag = Tag{lang: _cs} // cs - Danish Tag = Tag{lang: _da} // da - German Tag = Tag{lang: _de} // de - Greek Tag = Tag{lang: _el} // el - English Tag = Tag{lang: _en} // en - AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US - BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB - Spanish Tag = Tag{lang: _es} // es - EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES - LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419 - Estonian Tag = Tag{lang: _et} // et - Persian Tag = Tag{lang: _fa} // fa - Finnish Tag = Tag{lang: _fi} // fi - Filipino Tag = Tag{lang: _fil} // fil - French Tag = Tag{lang: _fr} // fr - CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA - Gujarati Tag = Tag{lang: _gu} // gu - Hebrew Tag = Tag{lang: _he} // he - Hindi Tag = Tag{lang: _hi} // hi - Croatian Tag = Tag{lang: _hr} // hr - Hungarian Tag = Tag{lang: _hu} // hu - Armenian Tag = Tag{lang: _hy} // hy - Indonesian Tag = Tag{lang: _id} // id - Icelandic Tag = Tag{lang: _is} // is - Italian Tag = Tag{lang: _it} // it - Japanese Tag = Tag{lang: _ja} // ja - Georgian Tag = Tag{lang: _ka} // ka - Kazakh Tag = Tag{lang: _kk} // kk - Khmer Tag = Tag{lang: _km} // km - Kannada Tag = Tag{lang: _kn} // kn - Korean Tag = Tag{lang: _ko} // ko - Kirghiz Tag = Tag{lang: _ky} // ky - Lao Tag = Tag{lang: _lo} // lo - Lithuanian Tag = Tag{lang: _lt} // lt - Latvian Tag = Tag{lang: _lv} // lv - Macedonian Tag = Tag{lang: _mk} // mk - Malayalam Tag = Tag{lang: _ml} // ml - Mongolian Tag = Tag{lang: _mn} // mn - Marathi Tag = Tag{lang: _mr} // mr - Malay Tag = Tag{lang: _ms} // ms - Burmese Tag = Tag{lang: _my} // my - Nepali Tag = Tag{lang: _ne} // ne - Dutch Tag = Tag{lang: _nl} // nl - Norwegian Tag = Tag{lang: _no} // no - Punjabi Tag = Tag{lang: _pa} // pa - Polish Tag = Tag{lang: _pl} // pl - Portuguese Tag = Tag{lang: _pt} // pt - BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR - EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT - Romanian Tag = Tag{lang: _ro} // ro - Russian Tag = Tag{lang: _ru} // ru - Sinhala Tag = Tag{lang: _si} // si - Slovak Tag = Tag{lang: _sk} // sk - Slovenian Tag = Tag{lang: _sl} // sl - Albanian Tag = Tag{lang: _sq} // sq - Serbian Tag = Tag{lang: _sr} // sr - SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn - Swedish Tag = Tag{lang: _sv} // sv - Swahili Tag = Tag{lang: _sw} // sw - Tamil Tag = Tag{lang: _ta} // ta - Telugu Tag = Tag{lang: _te} // te - Thai Tag = Tag{lang: _th} // th - Turkish Tag = Tag{lang: _tr} // tr - Ukrainian Tag = Tag{lang: _uk} // uk - Urdu Tag = Tag{lang: _ur} // ur - Uzbek Tag = Tag{lang: _uz} // uz - Vietnamese Tag = Tag{lang: _vi} // vi - Chinese Tag = Tag{lang: _zh} // zh - SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans - TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant - Zulu Tag = Tag{lang: _zu} // zu + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) ) diff --git a/vendor/golang.org/x/text/secure/bidirule/BUILD b/vendor/golang.org/x/text/secure/bidirule/BUILD index dd284b8669..9d82acdd2e 100644 --- a/vendor/golang.org/x/text/secure/bidirule/BUILD +++ b/vendor/golang.org/x/text/secure/bidirule/BUILD @@ -2,7 +2,11 @@ load("@io_bazel_rules_go//go:def.bzl", "go_library") go_library( name = "go_default_library", - srcs = ["bidirule.go"], + srcs = [ + "bidirule.go", + "bidirule10.0.0.go", + "bidirule9.0.0.go", + ], importmap = "k8s.io/kubernetes/vendor/golang.org/x/text/secure/bidirule", importpath = "golang.org/x/text/secure/bidirule", visibility = ["//visibility:public"], diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule.go b/vendor/golang.org/x/text/secure/bidirule/bidirule.go index a7161bdd9b..e2b70f76c2 100644 --- a/vendor/golang.org/x/text/secure/bidirule/bidirule.go +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule.go @@ -155,6 +155,7 @@ func DirectionString(s string) bidi.Direction { e, sz := bidi.LookupString(s[i:]) if sz == 0 { i++ + continue } c := e.Class() if c == bidi.R || c == bidi.AL || c == bidi.AN { @@ -202,13 +203,6 @@ func (t *Transformer) isRTL() bool { return t.seen&isRTL != 0 } -func (t *Transformer) isFinal() bool { - if !t.isRTL() { - return true - } - return t.state == ruleLTRFinal || t.state == ruleRTLFinal || t.state == ruleInitial -} - // Reset implements transform.Transformer. func (t *Transformer) Reset() { *t = Transformer{} } diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go new file mode 100644 index 0000000000..e4c62289f9 --- /dev/null +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go @@ -0,0 +1,11 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.10 + +package bidirule + +func (t *Transformer) isFinal() bool { + return t.state == ruleLTRFinal || t.state == ruleRTLFinal || t.state == ruleInitial +} diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go new file mode 100644 index 0000000000..02b9e1e9d4 --- /dev/null +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go @@ -0,0 +1,14 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.10 + +package bidirule + +func (t *Transformer) isFinal() bool { + if !t.isRTL() { + return true + } + return t.state == ruleLTRFinal || t.state == ruleRTLFinal || t.state == ruleInitial +} diff --git a/vendor/golang.org/x/text/transform/transform.go b/vendor/golang.org/x/text/transform/transform.go index fe47b9b35f..919e3d950e 100644 --- a/vendor/golang.org/x/text/transform/transform.go +++ b/vendor/golang.org/x/text/transform/transform.go @@ -78,8 +78,8 @@ type SpanningTransformer interface { // considering the error err. // // A nil error means that all input bytes are known to be identical to the - // output produced by the Transformer. A nil error can be be returned - // regardless of whether atEOF is true. If err is nil, then then n must + // output produced by the Transformer. A nil error can be returned + // regardless of whether atEOF is true. If err is nil, then n must // equal len(src); the converse is not necessarily true. // // ErrEndOfSpan means that the Transformer output may differ from the diff --git a/vendor/golang.org/x/text/unicode/bidi/BUILD b/vendor/golang.org/x/text/unicode/bidi/BUILD index 90fca27edb..7002ce6d3b 100644 --- a/vendor/golang.org/x/text/unicode/bidi/BUILD +++ b/vendor/golang.org/x/text/unicode/bidi/BUILD @@ -7,7 +7,8 @@ go_library( "bracket.go", "core.go", "prop.go", - "tables.go", + "tables10.0.0.go", + "tables9.0.0.go", "trieval.go", ], importmap = "k8s.io/kubernetes/vendor/golang.org/x/text/unicode/bidi", diff --git a/vendor/golang.org/x/text/unicode/bidi/bidi.go b/vendor/golang.org/x/text/unicode/bidi/bidi.go index 3fc4a62521..e8edc54cc2 100644 --- a/vendor/golang.org/x/text/unicode/bidi/bidi.go +++ b/vendor/golang.org/x/text/unicode/bidi/bidi.go @@ -6,7 +6,7 @@ // Package bidi contains functionality for bidirectional text support. // -// See http://www.unicode.org/reports/tr9. +// See https://www.unicode.org/reports/tr9. // // NOTE: UNDER CONSTRUCTION. This API may change in backwards incompatible ways // and without notice. diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go index 601e259203..1853939791 100644 --- a/vendor/golang.org/x/text/unicode/bidi/bracket.go +++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go @@ -12,7 +12,7 @@ import ( // This file contains a port of the reference implementation of the // Bidi Parentheses Algorithm: -// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java +// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java // // The implementation in this file covers definitions BD14-BD16 and rule N0 // of UAX#9. @@ -246,7 +246,7 @@ func (p *bracketPairer) getStrongTypeN0(index int) Class { // assuming the given embedding direction. // // It returns ON if no strong type is found. If a single strong type is found, -// it returns this this type. Otherwise it returns the embedding direction. +// it returns this type. Otherwise it returns the embedding direction. // // TODO: use separate type for "strong" directionality. func (p *bracketPairer) classifyPairContent(loc bracketPair, dirEmbed Class) Class { diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go index d4c1399f0d..48d144008a 100644 --- a/vendor/golang.org/x/text/unicode/bidi/core.go +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -7,7 +7,7 @@ package bidi import "log" // This implementation is a port based on the reference implementation found at: -// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/ +// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/ // // described in Unicode Bidirectional Algorithm (UAX #9). // diff --git a/vendor/golang.org/x/text/unicode/bidi/gen.go b/vendor/golang.org/x/text/unicode/bidi/gen.go index 040f3013d5..987fc169cc 100644 --- a/vendor/golang.org/x/text/unicode/bidi/gen.go +++ b/vendor/golang.org/x/text/unicode/bidi/gen.go @@ -26,7 +26,7 @@ func main() { } // bidiClass names and codes taken from class "bc" in -// http://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt +// https://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt var bidiClass = map[string]Class{ "AL": AL, // ArabicLetter "AN": AN, // ArabicNumber @@ -59,7 +59,7 @@ func genTables() { log.Fatalf("Too many Class constants (%#x > 0x0F).", numClass) } w := gen.NewCodeWriter() - defer w.WriteGoFile(*outputFile, "bidi") + defer w.WriteVersionedGoFile(*outputFile, "bidi") gen.WriteUnicodeVersion(w) diff --git a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go index 51bd68fa7f..02c3b505d6 100644 --- a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go +++ b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go @@ -15,7 +15,7 @@ import ( ) // These tables are hand-extracted from: -// http://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt +// https://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt func visitDefaults(fn func(r rune, c Class)) { // first write default values for ranges listed above. visitRunes(fn, AL, []rune{ diff --git a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go new file mode 100644 index 0000000000..2e1ff19599 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go @@ -0,0 +1,1815 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// +build go1.10 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "10.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 16128 bytes (15.75 KiB). Checksum: 8122d83e461996f. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 228 blocks, 14592 entries, 14592 bytes +// The third block is the zero block. +var bidiValues = [14592]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x0001, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x000d, 0x5ec: 0x000d, 0x5ed: 0x000d, 0x5ee: 0x000d, 0x5ef: 0x000d, + 0x5f0: 0x0001, 0x5f1: 0x0001, 0x5f2: 0x0001, 0x5f3: 0x0001, 0x5f4: 0x0001, 0x5f5: 0x0001, + 0x5f6: 0x0001, 0x5f7: 0x0001, 0x5f8: 0x0001, 0x5f9: 0x0001, 0x5fa: 0x0001, 0x5fb: 0x0001, + 0x5fc: 0x0001, 0x5fd: 0x0001, 0x5fe: 0x0001, 0x5ff: 0x0001, + // Block 0x18, offset 0x600 + 0x600: 0x0001, 0x601: 0x0001, 0x602: 0x0001, 0x603: 0x0001, 0x604: 0x0001, 0x605: 0x0001, + 0x606: 0x0001, 0x607: 0x0001, 0x608: 0x0001, 0x609: 0x0001, 0x60a: 0x0001, 0x60b: 0x0001, + 0x60c: 0x0001, 0x60d: 0x0001, 0x60e: 0x0001, 0x60f: 0x0001, 0x610: 0x0001, 0x611: 0x0001, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x0001, 0x619: 0x0001, 0x61a: 0x0001, 0x61b: 0x0001, 0x61c: 0x0001, 0x61d: 0x0001, + 0x61e: 0x0001, 0x61f: 0x0001, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000d, 0x64b: 0x000d, + 0x64c: 0x000d, 0x64d: 0x000d, 0x64e: 0x000d, 0x64f: 0x000d, 0x650: 0x000d, 0x651: 0x000d, + 0x652: 0x000d, 0x653: 0x000d, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, + 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa8a: 0x000c, + 0xa92: 0x000c, 0xa93: 0x000c, 0xa94: 0x000c, 0xa96: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaf1: 0x000c, 0xaf4: 0x000c, 0xaf5: 0x000c, + 0xaf6: 0x000c, 0xaf7: 0x000c, 0xaf8: 0x000c, 0xaf9: 0x000c, 0xafa: 0x000c, + 0xaff: 0x0004, + // Block 0x2c, offset 0xb00 + 0xb07: 0x000c, 0xb08: 0x000c, 0xb09: 0x000c, 0xb0a: 0x000c, 0xb0b: 0x000c, + 0xb0c: 0x000c, 0xb0d: 0x000c, 0xb0e: 0x000c, + // Block 0x2d, offset 0xb40 + 0xb71: 0x000c, 0xb74: 0x000c, 0xb75: 0x000c, + 0xb76: 0x000c, 0xb77: 0x000c, 0xb78: 0x000c, 0xb79: 0x000c, 0xb7b: 0x000c, + 0xb7c: 0x000c, + // Block 0x2e, offset 0xb80 + 0xb88: 0x000c, 0xb89: 0x000c, 0xb8a: 0x000c, 0xb8b: 0x000c, + 0xb8c: 0x000c, 0xb8d: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbd8: 0x000c, 0xbd9: 0x000c, + 0xbf5: 0x000c, + 0xbf7: 0x000c, 0xbf9: 0x000c, 0xbfa: 0x003a, 0xbfb: 0x002a, + 0xbfc: 0x003a, 0xbfd: 0x002a, + // Block 0x30, offset 0xc00 + 0xc31: 0x000c, 0xc32: 0x000c, 0xc33: 0x000c, 0xc34: 0x000c, 0xc35: 0x000c, + 0xc36: 0x000c, 0xc37: 0x000c, 0xc38: 0x000c, 0xc39: 0x000c, 0xc3a: 0x000c, 0xc3b: 0x000c, + 0xc3c: 0x000c, 0xc3d: 0x000c, 0xc3e: 0x000c, + // Block 0x31, offset 0xc40 + 0xc40: 0x000c, 0xc41: 0x000c, 0xc42: 0x000c, 0xc43: 0x000c, 0xc44: 0x000c, + 0xc46: 0x000c, 0xc47: 0x000c, + 0xc4d: 0x000c, 0xc4e: 0x000c, 0xc4f: 0x000c, 0xc50: 0x000c, 0xc51: 0x000c, + 0xc52: 0x000c, 0xc53: 0x000c, 0xc54: 0x000c, 0xc55: 0x000c, 0xc56: 0x000c, 0xc57: 0x000c, + 0xc59: 0x000c, 0xc5a: 0x000c, 0xc5b: 0x000c, 0xc5c: 0x000c, 0xc5d: 0x000c, + 0xc5e: 0x000c, 0xc5f: 0x000c, 0xc60: 0x000c, 0xc61: 0x000c, 0xc62: 0x000c, 0xc63: 0x000c, + 0xc64: 0x000c, 0xc65: 0x000c, 0xc66: 0x000c, 0xc67: 0x000c, 0xc68: 0x000c, 0xc69: 0x000c, + 0xc6a: 0x000c, 0xc6b: 0x000c, 0xc6c: 0x000c, 0xc6d: 0x000c, 0xc6e: 0x000c, 0xc6f: 0x000c, + 0xc70: 0x000c, 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, + // Block 0x32, offset 0xc80 + 0xc86: 0x000c, + // Block 0x33, offset 0xcc0 + 0xced: 0x000c, 0xcee: 0x000c, 0xcef: 0x000c, + 0xcf0: 0x000c, 0xcf2: 0x000c, 0xcf3: 0x000c, 0xcf4: 0x000c, 0xcf5: 0x000c, + 0xcf6: 0x000c, 0xcf7: 0x000c, 0xcf9: 0x000c, 0xcfa: 0x000c, + 0xcfd: 0x000c, 0xcfe: 0x000c, + // Block 0x34, offset 0xd00 + 0xd18: 0x000c, 0xd19: 0x000c, + 0xd1e: 0x000c, 0xd1f: 0x000c, 0xd20: 0x000c, + 0xd31: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, + // Block 0x35, offset 0xd40 + 0xd42: 0x000c, 0xd45: 0x000c, + 0xd46: 0x000c, + 0xd4d: 0x000c, + 0xd5d: 0x000c, + // Block 0x36, offset 0xd80 + 0xd9d: 0x000c, + 0xd9e: 0x000c, 0xd9f: 0x000c, + // Block 0x37, offset 0xdc0 + 0xdd0: 0x000a, 0xdd1: 0x000a, + 0xdd2: 0x000a, 0xdd3: 0x000a, 0xdd4: 0x000a, 0xdd5: 0x000a, 0xdd6: 0x000a, 0xdd7: 0x000a, + 0xdd8: 0x000a, 0xdd9: 0x000a, + // Block 0x38, offset 0xe00 + 0xe00: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0009, + 0xe5b: 0x007a, 0xe5c: 0x006a, + // Block 0x3a, offset 0xe80 + 0xe92: 0x000c, 0xe93: 0x000c, 0xe94: 0x000c, + 0xeb2: 0x000c, 0xeb3: 0x000c, 0xeb4: 0x000c, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf34: 0x000c, 0xf35: 0x000c, + 0xf37: 0x000c, 0xf38: 0x000c, 0xf39: 0x000c, 0xf3a: 0x000c, 0xf3b: 0x000c, + 0xf3c: 0x000c, 0xf3d: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf46: 0x000c, 0xf49: 0x000c, 0xf4a: 0x000c, 0xf4b: 0x000c, + 0xf4c: 0x000c, 0xf4d: 0x000c, 0xf4e: 0x000c, 0xf4f: 0x000c, 0xf50: 0x000c, 0xf51: 0x000c, + 0xf52: 0x000c, 0xf53: 0x000c, + 0xf5b: 0x0004, 0xf5d: 0x000c, + 0xf70: 0x000a, 0xf71: 0x000a, 0xf72: 0x000a, 0xf73: 0x000a, 0xf74: 0x000a, 0xf75: 0x000a, + 0xf76: 0x000a, 0xf77: 0x000a, 0xf78: 0x000a, 0xf79: 0x000a, + // Block 0x3e, offset 0xf80 + 0xf80: 0x000a, 0xf81: 0x000a, 0xf82: 0x000a, 0xf83: 0x000a, 0xf84: 0x000a, 0xf85: 0x000a, + 0xf86: 0x000a, 0xf87: 0x000a, 0xf88: 0x000a, 0xf89: 0x000a, 0xf8a: 0x000a, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000b, + // Block 0x3f, offset 0xfc0 + 0xfc5: 0x000c, + 0xfc6: 0x000c, + 0xfe9: 0x000c, + // Block 0x40, offset 0x1000 + 0x1020: 0x000c, 0x1021: 0x000c, 0x1022: 0x000c, + 0x1027: 0x000c, 0x1028: 0x000c, + 0x1032: 0x000c, + 0x1039: 0x000c, 0x103a: 0x000c, 0x103b: 0x000c, + // Block 0x41, offset 0x1040 + 0x1040: 0x000a, 0x1044: 0x000a, 0x1045: 0x000a, + // Block 0x42, offset 0x1080 + 0x109e: 0x000a, 0x109f: 0x000a, 0x10a0: 0x000a, 0x10a1: 0x000a, 0x10a2: 0x000a, 0x10a3: 0x000a, + 0x10a4: 0x000a, 0x10a5: 0x000a, 0x10a6: 0x000a, 0x10a7: 0x000a, 0x10a8: 0x000a, 0x10a9: 0x000a, + 0x10aa: 0x000a, 0x10ab: 0x000a, 0x10ac: 0x000a, 0x10ad: 0x000a, 0x10ae: 0x000a, 0x10af: 0x000a, + 0x10b0: 0x000a, 0x10b1: 0x000a, 0x10b2: 0x000a, 0x10b3: 0x000a, 0x10b4: 0x000a, 0x10b5: 0x000a, + 0x10b6: 0x000a, 0x10b7: 0x000a, 0x10b8: 0x000a, 0x10b9: 0x000a, 0x10ba: 0x000a, 0x10bb: 0x000a, + 0x10bc: 0x000a, 0x10bd: 0x000a, 0x10be: 0x000a, 0x10bf: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10d7: 0x000c, + 0x10d8: 0x000c, 0x10db: 0x000c, + // Block 0x44, offset 0x1100 + 0x1116: 0x000c, + 0x1118: 0x000c, 0x1119: 0x000c, 0x111a: 0x000c, 0x111b: 0x000c, 0x111c: 0x000c, 0x111d: 0x000c, + 0x111e: 0x000c, 0x1120: 0x000c, 0x1122: 0x000c, + 0x1125: 0x000c, 0x1126: 0x000c, 0x1127: 0x000c, 0x1128: 0x000c, 0x1129: 0x000c, + 0x112a: 0x000c, 0x112b: 0x000c, 0x112c: 0x000c, + 0x1133: 0x000c, 0x1134: 0x000c, 0x1135: 0x000c, + 0x1136: 0x000c, 0x1137: 0x000c, 0x1138: 0x000c, 0x1139: 0x000c, 0x113a: 0x000c, 0x113b: 0x000c, + 0x113c: 0x000c, 0x113f: 0x000c, + // Block 0x45, offset 0x1140 + 0x1170: 0x000c, 0x1171: 0x000c, 0x1172: 0x000c, 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117d: 0x000c, 0x117e: 0x000c, + // Block 0x46, offset 0x1180 + 0x1180: 0x000c, 0x1181: 0x000c, 0x1182: 0x000c, 0x1183: 0x000c, + 0x11b4: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, + 0x11bc: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c2: 0x000c, + 0x11eb: 0x000c, 0x11ec: 0x000c, 0x11ed: 0x000c, 0x11ee: 0x000c, 0x11ef: 0x000c, + 0x11f0: 0x000c, 0x11f1: 0x000c, 0x11f2: 0x000c, 0x11f3: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, + 0x1222: 0x000c, 0x1223: 0x000c, + 0x1224: 0x000c, 0x1225: 0x000c, 0x1228: 0x000c, 0x1229: 0x000c, + 0x122b: 0x000c, 0x122c: 0x000c, 0x122d: 0x000c, + // Block 0x49, offset 0x1240 + 0x1266: 0x000c, 0x1268: 0x000c, 0x1269: 0x000c, + 0x126d: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, + // Block 0x4a, offset 0x1280 + 0x12ac: 0x000c, 0x12ad: 0x000c, 0x12ae: 0x000c, 0x12af: 0x000c, + 0x12b0: 0x000c, 0x12b1: 0x000c, 0x12b2: 0x000c, 0x12b3: 0x000c, + 0x12b6: 0x000c, 0x12b7: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12d0: 0x000c, 0x12d1: 0x000c, + 0x12d2: 0x000c, 0x12d4: 0x000c, 0x12d5: 0x000c, 0x12d6: 0x000c, 0x12d7: 0x000c, + 0x12d8: 0x000c, 0x12d9: 0x000c, 0x12da: 0x000c, 0x12db: 0x000c, 0x12dc: 0x000c, 0x12dd: 0x000c, + 0x12de: 0x000c, 0x12df: 0x000c, 0x12e0: 0x000c, 0x12e2: 0x000c, 0x12e3: 0x000c, + 0x12e4: 0x000c, 0x12e5: 0x000c, 0x12e6: 0x000c, 0x12e7: 0x000c, 0x12e8: 0x000c, + 0x12ed: 0x000c, + 0x12f4: 0x000c, + 0x12f8: 0x000c, 0x12f9: 0x000c, + // Block 0x4c, offset 0x1300 + 0x1300: 0x000c, 0x1301: 0x000c, 0x1302: 0x000c, 0x1303: 0x000c, 0x1304: 0x000c, 0x1305: 0x000c, + 0x1306: 0x000c, 0x1307: 0x000c, 0x1308: 0x000c, 0x1309: 0x000c, 0x130a: 0x000c, 0x130b: 0x000c, + 0x130c: 0x000c, 0x130d: 0x000c, 0x130e: 0x000c, 0x130f: 0x000c, 0x1310: 0x000c, 0x1311: 0x000c, + 0x1312: 0x000c, 0x1313: 0x000c, 0x1314: 0x000c, 0x1315: 0x000c, 0x1316: 0x000c, 0x1317: 0x000c, + 0x1318: 0x000c, 0x1319: 0x000c, 0x131a: 0x000c, 0x131b: 0x000c, 0x131c: 0x000c, 0x131d: 0x000c, + 0x131e: 0x000c, 0x131f: 0x000c, 0x1320: 0x000c, 0x1321: 0x000c, 0x1322: 0x000c, 0x1323: 0x000c, + 0x1324: 0x000c, 0x1325: 0x000c, 0x1326: 0x000c, 0x1327: 0x000c, 0x1328: 0x000c, 0x1329: 0x000c, + 0x132a: 0x000c, 0x132b: 0x000c, 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, 0x1334: 0x000c, 0x1335: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, 0x1338: 0x000c, 0x1339: 0x000c, 0x133b: 0x000c, + 0x133c: 0x000c, 0x133d: 0x000c, 0x133e: 0x000c, 0x133f: 0x000c, + // Block 0x4d, offset 0x1340 + 0x137d: 0x000a, 0x137f: 0x000a, + // Block 0x4e, offset 0x1380 + 0x1380: 0x000a, 0x1381: 0x000a, + 0x138d: 0x000a, 0x138e: 0x000a, 0x138f: 0x000a, + 0x139d: 0x000a, + 0x139e: 0x000a, 0x139f: 0x000a, + 0x13ad: 0x000a, 0x13ae: 0x000a, 0x13af: 0x000a, + 0x13bd: 0x000a, 0x13be: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0009, 0x13c1: 0x0009, 0x13c2: 0x0009, 0x13c3: 0x0009, 0x13c4: 0x0009, 0x13c5: 0x0009, + 0x13c6: 0x0009, 0x13c7: 0x0009, 0x13c8: 0x0009, 0x13c9: 0x0009, 0x13ca: 0x0009, 0x13cb: 0x000b, + 0x13cc: 0x000b, 0x13cd: 0x000b, 0x13cf: 0x0001, 0x13d0: 0x000a, 0x13d1: 0x000a, + 0x13d2: 0x000a, 0x13d3: 0x000a, 0x13d4: 0x000a, 0x13d5: 0x000a, 0x13d6: 0x000a, 0x13d7: 0x000a, + 0x13d8: 0x000a, 0x13d9: 0x000a, 0x13da: 0x000a, 0x13db: 0x000a, 0x13dc: 0x000a, 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, 0x13e0: 0x000a, 0x13e1: 0x000a, 0x13e2: 0x000a, 0x13e3: 0x000a, + 0x13e4: 0x000a, 0x13e5: 0x000a, 0x13e6: 0x000a, 0x13e7: 0x000a, 0x13e8: 0x0009, 0x13e9: 0x0007, + 0x13ea: 0x000e, 0x13eb: 0x000e, 0x13ec: 0x000e, 0x13ed: 0x000e, 0x13ee: 0x000e, 0x13ef: 0x0006, + 0x13f0: 0x0004, 0x13f1: 0x0004, 0x13f2: 0x0004, 0x13f3: 0x0004, 0x13f4: 0x0004, 0x13f5: 0x000a, + 0x13f6: 0x000a, 0x13f7: 0x000a, 0x13f8: 0x000a, 0x13f9: 0x000a, 0x13fa: 0x000a, 0x13fb: 0x000a, + 0x13fc: 0x000a, 0x13fd: 0x000a, 0x13fe: 0x000a, 0x13ff: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x000a, 0x1401: 0x000a, 0x1402: 0x000a, 0x1403: 0x000a, 0x1404: 0x0006, 0x1405: 0x009a, + 0x1406: 0x008a, 0x1407: 0x000a, 0x1408: 0x000a, 0x1409: 0x000a, 0x140a: 0x000a, 0x140b: 0x000a, + 0x140c: 0x000a, 0x140d: 0x000a, 0x140e: 0x000a, 0x140f: 0x000a, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x0009, 0x1420: 0x000b, 0x1421: 0x000b, 0x1422: 0x000b, 0x1423: 0x000b, + 0x1424: 0x000b, 0x1425: 0x000b, 0x1426: 0x000e, 0x1427: 0x000e, 0x1428: 0x000e, 0x1429: 0x000e, + 0x142a: 0x000b, 0x142b: 0x000b, 0x142c: 0x000b, 0x142d: 0x000b, 0x142e: 0x000b, 0x142f: 0x000b, + 0x1430: 0x0002, 0x1434: 0x0002, 0x1435: 0x0002, + 0x1436: 0x0002, 0x1437: 0x0002, 0x1438: 0x0002, 0x1439: 0x0002, 0x143a: 0x0003, 0x143b: 0x0003, + 0x143c: 0x000a, 0x143d: 0x009a, 0x143e: 0x008a, + // Block 0x51, offset 0x1440 + 0x1440: 0x0002, 0x1441: 0x0002, 0x1442: 0x0002, 0x1443: 0x0002, 0x1444: 0x0002, 0x1445: 0x0002, + 0x1446: 0x0002, 0x1447: 0x0002, 0x1448: 0x0002, 0x1449: 0x0002, 0x144a: 0x0003, 0x144b: 0x0003, + 0x144c: 0x000a, 0x144d: 0x009a, 0x144e: 0x008a, + 0x1460: 0x0004, 0x1461: 0x0004, 0x1462: 0x0004, 0x1463: 0x0004, + 0x1464: 0x0004, 0x1465: 0x0004, 0x1466: 0x0004, 0x1467: 0x0004, 0x1468: 0x0004, 0x1469: 0x0004, + 0x146a: 0x0004, 0x146b: 0x0004, 0x146c: 0x0004, 0x146d: 0x0004, 0x146e: 0x0004, 0x146f: 0x0004, + 0x1470: 0x0004, 0x1471: 0x0004, 0x1472: 0x0004, 0x1473: 0x0004, 0x1474: 0x0004, 0x1475: 0x0004, + 0x1476: 0x0004, 0x1477: 0x0004, 0x1478: 0x0004, 0x1479: 0x0004, 0x147a: 0x0004, 0x147b: 0x0004, + 0x147c: 0x0004, 0x147d: 0x0004, 0x147e: 0x0004, 0x147f: 0x0004, + // Block 0x52, offset 0x1480 + 0x1480: 0x0004, 0x1481: 0x0004, 0x1482: 0x0004, 0x1483: 0x0004, 0x1484: 0x0004, 0x1485: 0x0004, + 0x1486: 0x0004, 0x1487: 0x0004, 0x1488: 0x0004, 0x1489: 0x0004, 0x148a: 0x0004, 0x148b: 0x0004, + 0x148c: 0x0004, 0x148d: 0x0004, 0x148e: 0x0004, 0x148f: 0x0004, 0x1490: 0x000c, 0x1491: 0x000c, + 0x1492: 0x000c, 0x1493: 0x000c, 0x1494: 0x000c, 0x1495: 0x000c, 0x1496: 0x000c, 0x1497: 0x000c, + 0x1498: 0x000c, 0x1499: 0x000c, 0x149a: 0x000c, 0x149b: 0x000c, 0x149c: 0x000c, 0x149d: 0x000c, + 0x149e: 0x000c, 0x149f: 0x000c, 0x14a0: 0x000c, 0x14a1: 0x000c, 0x14a2: 0x000c, 0x14a3: 0x000c, + 0x14a4: 0x000c, 0x14a5: 0x000c, 0x14a6: 0x000c, 0x14a7: 0x000c, 0x14a8: 0x000c, 0x14a9: 0x000c, + 0x14aa: 0x000c, 0x14ab: 0x000c, 0x14ac: 0x000c, 0x14ad: 0x000c, 0x14ae: 0x000c, 0x14af: 0x000c, + 0x14b0: 0x000c, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x000a, 0x14c1: 0x000a, 0x14c3: 0x000a, 0x14c4: 0x000a, 0x14c5: 0x000a, + 0x14c6: 0x000a, 0x14c8: 0x000a, 0x14c9: 0x000a, + 0x14d4: 0x000a, 0x14d6: 0x000a, 0x14d7: 0x000a, + 0x14d8: 0x000a, + 0x14de: 0x000a, 0x14df: 0x000a, 0x14e0: 0x000a, 0x14e1: 0x000a, 0x14e2: 0x000a, 0x14e3: 0x000a, + 0x14e5: 0x000a, 0x14e7: 0x000a, 0x14e9: 0x000a, + 0x14ee: 0x0004, + 0x14fa: 0x000a, 0x14fb: 0x000a, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1502: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, + 0x150a: 0x000a, 0x150b: 0x000a, + 0x150c: 0x000a, 0x150d: 0x000a, 0x1510: 0x000a, 0x1511: 0x000a, + 0x1512: 0x000a, 0x1513: 0x000a, 0x1514: 0x000a, 0x1515: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, 0x1519: 0x000a, 0x151a: 0x000a, 0x151b: 0x000a, 0x151c: 0x000a, 0x151d: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, + // Block 0x55, offset 0x1540 + 0x1549: 0x000a, 0x154a: 0x000a, 0x154b: 0x000a, + 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, 0x1560: 0x000a, 0x1561: 0x000a, 0x1562: 0x000a, 0x1563: 0x000a, + 0x1564: 0x000a, 0x1565: 0x000a, 0x1566: 0x000a, 0x1567: 0x000a, 0x1568: 0x000a, 0x1569: 0x000a, + 0x156a: 0x000a, 0x156b: 0x000a, 0x156c: 0x000a, 0x156d: 0x000a, 0x156e: 0x000a, 0x156f: 0x000a, + 0x1570: 0x000a, 0x1571: 0x000a, 0x1572: 0x000a, 0x1573: 0x000a, 0x1574: 0x000a, 0x1575: 0x000a, + 0x1576: 0x000a, 0x1577: 0x000a, 0x1578: 0x000a, 0x1579: 0x000a, 0x157a: 0x000a, 0x157b: 0x000a, + 0x157c: 0x000a, 0x157d: 0x000a, 0x157e: 0x000a, 0x157f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1580: 0x000a, 0x1581: 0x000a, 0x1582: 0x000a, 0x1583: 0x000a, 0x1584: 0x000a, 0x1585: 0x000a, + 0x1586: 0x000a, 0x1587: 0x000a, 0x1588: 0x000a, 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x158c: 0x000a, 0x158d: 0x000a, 0x158e: 0x000a, 0x158f: 0x000a, 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x0003, 0x15d3: 0x0004, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x003a, 0x1609: 0x002a, 0x160a: 0x003a, 0x160b: 0x002a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x000a, 0x1613: 0x000a, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x009a, + 0x162a: 0x008a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + // Block 0x59, offset 0x1640 + 0x167b: 0x000a, + 0x167c: 0x000a, 0x167d: 0x000a, 0x167e: 0x000a, 0x167f: 0x000a, + // Block 0x5a, offset 0x1680 + 0x1680: 0x000a, 0x1681: 0x000a, 0x1682: 0x000a, 0x1683: 0x000a, 0x1684: 0x000a, 0x1685: 0x000a, + 0x1686: 0x000a, 0x1687: 0x000a, 0x1688: 0x000a, 0x1689: 0x000a, 0x168a: 0x000a, 0x168b: 0x000a, + 0x168c: 0x000a, 0x168d: 0x000a, 0x168e: 0x000a, 0x168f: 0x000a, 0x1690: 0x000a, 0x1691: 0x000a, + 0x1692: 0x000a, 0x1693: 0x000a, 0x1694: 0x000a, 0x1696: 0x000a, 0x1697: 0x000a, + 0x1698: 0x000a, 0x1699: 0x000a, 0x169a: 0x000a, 0x169b: 0x000a, 0x169c: 0x000a, 0x169d: 0x000a, + 0x169e: 0x000a, 0x169f: 0x000a, 0x16a0: 0x000a, 0x16a1: 0x000a, 0x16a2: 0x000a, 0x16a3: 0x000a, + 0x16a4: 0x000a, 0x16a5: 0x000a, 0x16a6: 0x000a, 0x16a7: 0x000a, 0x16a8: 0x000a, 0x16a9: 0x000a, + 0x16aa: 0x000a, 0x16ab: 0x000a, 0x16ac: 0x000a, 0x16ad: 0x000a, 0x16ae: 0x000a, 0x16af: 0x000a, + 0x16b0: 0x000a, 0x16b1: 0x000a, 0x16b2: 0x000a, 0x16b3: 0x000a, 0x16b4: 0x000a, 0x16b5: 0x000a, + 0x16b6: 0x000a, 0x16b7: 0x000a, 0x16b8: 0x000a, 0x16b9: 0x000a, 0x16ba: 0x000a, 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d5: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, + 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, 0x1727: 0x000a, 0x1728: 0x000a, 0x1729: 0x000a, + 0x172a: 0x000a, 0x172b: 0x000a, 0x172c: 0x000a, 0x172d: 0x000a, 0x172e: 0x000a, 0x172f: 0x000a, + 0x1730: 0x000a, 0x1731: 0x000a, 0x1732: 0x000a, 0x1733: 0x000a, 0x1734: 0x000a, 0x1735: 0x000a, + 0x1736: 0x000a, 0x1737: 0x000a, 0x1738: 0x000a, 0x1739: 0x000a, 0x173a: 0x000a, 0x173b: 0x000a, + 0x173c: 0x000a, 0x173d: 0x000a, 0x173e: 0x000a, 0x173f: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x0002, 0x1749: 0x0002, 0x174a: 0x0002, 0x174b: 0x0002, + 0x174c: 0x0002, 0x174d: 0x0002, 0x174e: 0x0002, 0x174f: 0x0002, 0x1750: 0x0002, 0x1751: 0x0002, + 0x1752: 0x0002, 0x1753: 0x0002, 0x1754: 0x0002, 0x1755: 0x0002, 0x1756: 0x0002, 0x1757: 0x0002, + 0x1758: 0x0002, 0x1759: 0x0002, 0x175a: 0x0002, 0x175b: 0x0002, + // Block 0x5e, offset 0x1780 + 0x17aa: 0x000a, 0x17ab: 0x000a, 0x17ac: 0x000a, 0x17ad: 0x000a, 0x17ae: 0x000a, 0x17af: 0x000a, + 0x17b0: 0x000a, 0x17b1: 0x000a, 0x17b2: 0x000a, 0x17b3: 0x000a, 0x17b4: 0x000a, 0x17b5: 0x000a, + 0x17b6: 0x000a, 0x17b7: 0x000a, 0x17b8: 0x000a, 0x17b9: 0x000a, 0x17ba: 0x000a, 0x17bb: 0x000a, + 0x17bc: 0x000a, 0x17bd: 0x000a, 0x17be: 0x000a, 0x17bf: 0x000a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x000a, 0x17c1: 0x000a, 0x17c2: 0x000a, 0x17c3: 0x000a, 0x17c4: 0x000a, 0x17c5: 0x000a, + 0x17c6: 0x000a, 0x17c7: 0x000a, 0x17c8: 0x000a, 0x17c9: 0x000a, 0x17ca: 0x000a, 0x17cb: 0x000a, + 0x17cc: 0x000a, 0x17cd: 0x000a, 0x17ce: 0x000a, 0x17cf: 0x000a, 0x17d0: 0x000a, 0x17d1: 0x000a, + 0x17d2: 0x000a, 0x17d3: 0x000a, 0x17d4: 0x000a, 0x17d5: 0x000a, 0x17d6: 0x000a, 0x17d7: 0x000a, + 0x17d8: 0x000a, 0x17d9: 0x000a, 0x17da: 0x000a, 0x17db: 0x000a, 0x17dc: 0x000a, 0x17dd: 0x000a, + 0x17de: 0x000a, 0x17df: 0x000a, 0x17e0: 0x000a, 0x17e1: 0x000a, 0x17e2: 0x000a, 0x17e3: 0x000a, + 0x17e4: 0x000a, 0x17e5: 0x000a, 0x17e6: 0x000a, 0x17e7: 0x000a, 0x17e8: 0x000a, 0x17e9: 0x000a, + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x003a, 0x1829: 0x002a, + 0x182a: 0x003a, 0x182b: 0x002a, 0x182c: 0x003a, 0x182d: 0x002a, 0x182e: 0x003a, 0x182f: 0x002a, + 0x1830: 0x003a, 0x1831: 0x002a, 0x1832: 0x003a, 0x1833: 0x002a, 0x1834: 0x003a, 0x1835: 0x002a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x009a, + 0x1846: 0x008a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x003a, 0x1867: 0x002a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x000a, 0x1871: 0x000a, 0x1872: 0x000a, 0x1873: 0x000a, 0x1874: 0x000a, 0x1875: 0x000a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x007a, 0x1884: 0x006a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x00ba, 0x1888: 0x00aa, 0x1889: 0x009a, 0x188a: 0x008a, 0x188b: 0x007a, + 0x188c: 0x006a, 0x188d: 0x00da, 0x188e: 0x002a, 0x188f: 0x003a, 0x1890: 0x00ca, 0x1891: 0x009a, + 0x1892: 0x008a, 0x1893: 0x007a, 0x1894: 0x006a, 0x1895: 0x009a, 0x1896: 0x008a, 0x1897: 0x00ba, + 0x1898: 0x00aa, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x000a, 0x18a7: 0x000a, 0x18a8: 0x000a, 0x18a9: 0x000a, + 0x18aa: 0x000a, 0x18ab: 0x000a, 0x18ac: 0x000a, 0x18ad: 0x000a, 0x18ae: 0x000a, 0x18af: 0x000a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x000a, 0x18c4: 0x000a, 0x18c5: 0x000a, + 0x18c6: 0x000a, 0x18c7: 0x000a, 0x18c8: 0x000a, 0x18c9: 0x000a, 0x18ca: 0x000a, 0x18cb: 0x000a, + 0x18cc: 0x000a, 0x18cd: 0x000a, 0x18ce: 0x000a, 0x18cf: 0x000a, 0x18d0: 0x000a, 0x18d1: 0x000a, + 0x18d2: 0x000a, 0x18d3: 0x000a, 0x18d4: 0x000a, 0x18d5: 0x000a, 0x18d6: 0x000a, 0x18d7: 0x000a, + 0x18d8: 0x003a, 0x18d9: 0x002a, 0x18da: 0x003a, 0x18db: 0x002a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x003a, 0x18fd: 0x002a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x000a, 0x1919: 0x000a, 0x191a: 0x000a, 0x191b: 0x000a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x000a, 0x193d: 0x000a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, 0x1974: 0x000a, 0x1975: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, + 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, + 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x2325: 0x000c, 0x2328: 0x000c, + 0x232d: 0x000c, + // Block 0x8d, offset 0x2340 + 0x235d: 0x0001, + 0x235e: 0x000c, 0x235f: 0x0001, 0x2360: 0x0001, 0x2361: 0x0001, 0x2362: 0x0001, 0x2363: 0x0001, + 0x2364: 0x0001, 0x2365: 0x0001, 0x2366: 0x0001, 0x2367: 0x0001, 0x2368: 0x0001, 0x2369: 0x0003, + 0x236a: 0x0001, 0x236b: 0x0001, 0x236c: 0x0001, 0x236d: 0x0001, 0x236e: 0x0001, 0x236f: 0x0001, + 0x2370: 0x0001, 0x2371: 0x0001, 0x2372: 0x0001, 0x2373: 0x0001, 0x2374: 0x0001, 0x2375: 0x0001, + 0x2376: 0x0001, 0x2377: 0x0001, 0x2378: 0x0001, 0x2379: 0x0001, 0x237a: 0x0001, 0x237b: 0x0001, + 0x237c: 0x0001, 0x237d: 0x0001, 0x237e: 0x0001, 0x237f: 0x0001, + // Block 0x8e, offset 0x2380 + 0x2380: 0x0001, 0x2381: 0x0001, 0x2382: 0x0001, 0x2383: 0x0001, 0x2384: 0x0001, 0x2385: 0x0001, + 0x2386: 0x0001, 0x2387: 0x0001, 0x2388: 0x0001, 0x2389: 0x0001, 0x238a: 0x0001, 0x238b: 0x0001, + 0x238c: 0x0001, 0x238d: 0x0001, 0x238e: 0x0001, 0x238f: 0x0001, 0x2390: 0x000d, 0x2391: 0x000d, + 0x2392: 0x000d, 0x2393: 0x000d, 0x2394: 0x000d, 0x2395: 0x000d, 0x2396: 0x000d, 0x2397: 0x000d, + 0x2398: 0x000d, 0x2399: 0x000d, 0x239a: 0x000d, 0x239b: 0x000d, 0x239c: 0x000d, 0x239d: 0x000d, + 0x239e: 0x000d, 0x239f: 0x000d, 0x23a0: 0x000d, 0x23a1: 0x000d, 0x23a2: 0x000d, 0x23a3: 0x000d, + 0x23a4: 0x000d, 0x23a5: 0x000d, 0x23a6: 0x000d, 0x23a7: 0x000d, 0x23a8: 0x000d, 0x23a9: 0x000d, + 0x23aa: 0x000d, 0x23ab: 0x000d, 0x23ac: 0x000d, 0x23ad: 0x000d, 0x23ae: 0x000d, 0x23af: 0x000d, + 0x23b0: 0x000d, 0x23b1: 0x000d, 0x23b2: 0x000d, 0x23b3: 0x000d, 0x23b4: 0x000d, 0x23b5: 0x000d, + 0x23b6: 0x000d, 0x23b7: 0x000d, 0x23b8: 0x000d, 0x23b9: 0x000d, 0x23ba: 0x000d, 0x23bb: 0x000d, + 0x23bc: 0x000d, 0x23bd: 0x000d, 0x23be: 0x000d, 0x23bf: 0x000d, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x000d, 0x23c1: 0x000d, 0x23c2: 0x000d, 0x23c3: 0x000d, 0x23c4: 0x000d, 0x23c5: 0x000d, + 0x23c6: 0x000d, 0x23c7: 0x000d, 0x23c8: 0x000d, 0x23c9: 0x000d, 0x23ca: 0x000d, 0x23cb: 0x000d, + 0x23cc: 0x000d, 0x23cd: 0x000d, 0x23ce: 0x000d, 0x23cf: 0x000d, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000a, 0x23ff: 0x000a, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000b, 0x2411: 0x000b, + 0x2412: 0x000b, 0x2413: 0x000b, 0x2414: 0x000b, 0x2415: 0x000b, 0x2416: 0x000b, 0x2417: 0x000b, + 0x2418: 0x000b, 0x2419: 0x000b, 0x241a: 0x000b, 0x241b: 0x000b, 0x241c: 0x000b, 0x241d: 0x000b, + 0x241e: 0x000b, 0x241f: 0x000b, 0x2420: 0x000b, 0x2421: 0x000b, 0x2422: 0x000b, 0x2423: 0x000b, + 0x2424: 0x000b, 0x2425: 0x000b, 0x2426: 0x000b, 0x2427: 0x000b, 0x2428: 0x000b, 0x2429: 0x000b, + 0x242a: 0x000b, 0x242b: 0x000b, 0x242c: 0x000b, 0x242d: 0x000b, 0x242e: 0x000b, 0x242f: 0x000b, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000a, 0x243e: 0x000d, 0x243f: 0x000d, + // Block 0x91, offset 0x2440 + 0x2440: 0x000c, 0x2441: 0x000c, 0x2442: 0x000c, 0x2443: 0x000c, 0x2444: 0x000c, 0x2445: 0x000c, + 0x2446: 0x000c, 0x2447: 0x000c, 0x2448: 0x000c, 0x2449: 0x000c, 0x244a: 0x000c, 0x244b: 0x000c, + 0x244c: 0x000c, 0x244d: 0x000c, 0x244e: 0x000c, 0x244f: 0x000c, 0x2450: 0x000a, 0x2451: 0x000a, + 0x2452: 0x000a, 0x2453: 0x000a, 0x2454: 0x000a, 0x2455: 0x000a, 0x2456: 0x000a, 0x2457: 0x000a, + 0x2458: 0x000a, 0x2459: 0x000a, + 0x2460: 0x000c, 0x2461: 0x000c, 0x2462: 0x000c, 0x2463: 0x000c, + 0x2464: 0x000c, 0x2465: 0x000c, 0x2466: 0x000c, 0x2467: 0x000c, 0x2468: 0x000c, 0x2469: 0x000c, + 0x246a: 0x000c, 0x246b: 0x000c, 0x246c: 0x000c, 0x246d: 0x000c, 0x246e: 0x000c, 0x246f: 0x000c, + 0x2470: 0x000a, 0x2471: 0x000a, 0x2472: 0x000a, 0x2473: 0x000a, 0x2474: 0x000a, 0x2475: 0x000a, + 0x2476: 0x000a, 0x2477: 0x000a, 0x2478: 0x000a, 0x2479: 0x000a, 0x247a: 0x000a, 0x247b: 0x000a, + 0x247c: 0x000a, 0x247d: 0x000a, 0x247e: 0x000a, 0x247f: 0x000a, + // Block 0x92, offset 0x2480 + 0x2480: 0x000a, 0x2481: 0x000a, 0x2482: 0x000a, 0x2483: 0x000a, 0x2484: 0x000a, 0x2485: 0x000a, + 0x2486: 0x000a, 0x2487: 0x000a, 0x2488: 0x000a, 0x2489: 0x000a, 0x248a: 0x000a, 0x248b: 0x000a, + 0x248c: 0x000a, 0x248d: 0x000a, 0x248e: 0x000a, 0x248f: 0x000a, 0x2490: 0x0006, 0x2491: 0x000a, + 0x2492: 0x0006, 0x2494: 0x000a, 0x2495: 0x0006, 0x2496: 0x000a, 0x2497: 0x000a, + 0x2498: 0x000a, 0x2499: 0x009a, 0x249a: 0x008a, 0x249b: 0x007a, 0x249c: 0x006a, 0x249d: 0x009a, + 0x249e: 0x008a, 0x249f: 0x0004, 0x24a0: 0x000a, 0x24a1: 0x000a, 0x24a2: 0x0003, 0x24a3: 0x0003, + 0x24a4: 0x000a, 0x24a5: 0x000a, 0x24a6: 0x000a, 0x24a8: 0x000a, 0x24a9: 0x0004, + 0x24aa: 0x0004, 0x24ab: 0x000a, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000d, 0x24be: 0x000d, 0x24bf: 0x000d, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000d, 0x24c1: 0x000d, 0x24c2: 0x000d, 0x24c3: 0x000d, 0x24c4: 0x000d, 0x24c5: 0x000d, + 0x24c6: 0x000d, 0x24c7: 0x000d, 0x24c8: 0x000d, 0x24c9: 0x000d, 0x24ca: 0x000d, 0x24cb: 0x000d, + 0x24cc: 0x000d, 0x24cd: 0x000d, 0x24ce: 0x000d, 0x24cf: 0x000d, 0x24d0: 0x000d, 0x24d1: 0x000d, + 0x24d2: 0x000d, 0x24d3: 0x000d, 0x24d4: 0x000d, 0x24d5: 0x000d, 0x24d6: 0x000d, 0x24d7: 0x000d, + 0x24d8: 0x000d, 0x24d9: 0x000d, 0x24da: 0x000d, 0x24db: 0x000d, 0x24dc: 0x000d, 0x24dd: 0x000d, + 0x24de: 0x000d, 0x24df: 0x000d, 0x24e0: 0x000d, 0x24e1: 0x000d, 0x24e2: 0x000d, 0x24e3: 0x000d, + 0x24e4: 0x000d, 0x24e5: 0x000d, 0x24e6: 0x000d, 0x24e7: 0x000d, 0x24e8: 0x000d, 0x24e9: 0x000d, + 0x24ea: 0x000d, 0x24eb: 0x000d, 0x24ec: 0x000d, 0x24ed: 0x000d, 0x24ee: 0x000d, 0x24ef: 0x000d, + 0x24f0: 0x000d, 0x24f1: 0x000d, 0x24f2: 0x000d, 0x24f3: 0x000d, 0x24f4: 0x000d, 0x24f5: 0x000d, + 0x24f6: 0x000d, 0x24f7: 0x000d, 0x24f8: 0x000d, 0x24f9: 0x000d, 0x24fa: 0x000d, 0x24fb: 0x000d, + 0x24fc: 0x000d, 0x24fd: 0x000d, 0x24fe: 0x000d, 0x24ff: 0x000b, + // Block 0x94, offset 0x2500 + 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x0004, 0x2504: 0x0004, 0x2505: 0x0004, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x003a, 0x2509: 0x002a, 0x250a: 0x000a, 0x250b: 0x0003, + 0x250c: 0x0006, 0x250d: 0x0003, 0x250e: 0x0006, 0x250f: 0x0006, 0x2510: 0x0002, 0x2511: 0x0002, + 0x2512: 0x0002, 0x2513: 0x0002, 0x2514: 0x0002, 0x2515: 0x0002, 0x2516: 0x0002, 0x2517: 0x0002, + 0x2518: 0x0002, 0x2519: 0x0002, 0x251a: 0x0006, 0x251b: 0x000a, 0x251c: 0x000a, 0x251d: 0x000a, + 0x251e: 0x000a, 0x251f: 0x000a, 0x2520: 0x000a, + 0x253b: 0x005a, + 0x253c: 0x000a, 0x253d: 0x004a, 0x253e: 0x000a, 0x253f: 0x000a, + // Block 0x95, offset 0x2540 + 0x2540: 0x000a, + 0x255b: 0x005a, 0x255c: 0x000a, 0x255d: 0x004a, + 0x255e: 0x000a, 0x255f: 0x00fa, 0x2560: 0x00ea, 0x2561: 0x000a, 0x2562: 0x003a, 0x2563: 0x002a, + 0x2564: 0x000a, 0x2565: 0x000a, + // Block 0x96, offset 0x2580 + 0x25a0: 0x0004, 0x25a1: 0x0004, 0x25a2: 0x000a, 0x25a3: 0x000a, + 0x25a4: 0x000a, 0x25a5: 0x0004, 0x25a6: 0x0004, 0x25a8: 0x000a, 0x25a9: 0x000a, + 0x25aa: 0x000a, 0x25ab: 0x000a, 0x25ac: 0x000a, 0x25ad: 0x000a, 0x25ae: 0x000a, + 0x25b0: 0x000b, 0x25b1: 0x000b, 0x25b2: 0x000b, 0x25b3: 0x000b, 0x25b4: 0x000b, 0x25b5: 0x000b, + 0x25b6: 0x000b, 0x25b7: 0x000b, 0x25b8: 0x000b, 0x25b9: 0x000a, 0x25ba: 0x000a, 0x25bb: 0x000a, + 0x25bc: 0x000a, 0x25bd: 0x000a, 0x25be: 0x000b, 0x25bf: 0x000b, + // Block 0x97, offset 0x25c0 + 0x25c1: 0x000a, + // Block 0x98, offset 0x2600 + 0x2600: 0x000a, 0x2601: 0x000a, 0x2602: 0x000a, 0x2603: 0x000a, 0x2604: 0x000a, 0x2605: 0x000a, + 0x2606: 0x000a, 0x2607: 0x000a, 0x2608: 0x000a, 0x2609: 0x000a, 0x260a: 0x000a, 0x260b: 0x000a, + 0x260c: 0x000a, 0x2610: 0x000a, 0x2611: 0x000a, + 0x2612: 0x000a, 0x2613: 0x000a, 0x2614: 0x000a, 0x2615: 0x000a, 0x2616: 0x000a, 0x2617: 0x000a, + 0x2618: 0x000a, 0x2619: 0x000a, 0x261a: 0x000a, 0x261b: 0x000a, + 0x2620: 0x000a, + // Block 0x99, offset 0x2640 + 0x267d: 0x000c, + // Block 0x9a, offset 0x2680 + 0x26a0: 0x000c, 0x26a1: 0x0002, 0x26a2: 0x0002, 0x26a3: 0x0002, + 0x26a4: 0x0002, 0x26a5: 0x0002, 0x26a6: 0x0002, 0x26a7: 0x0002, 0x26a8: 0x0002, 0x26a9: 0x0002, + 0x26aa: 0x0002, 0x26ab: 0x0002, 0x26ac: 0x0002, 0x26ad: 0x0002, 0x26ae: 0x0002, 0x26af: 0x0002, + 0x26b0: 0x0002, 0x26b1: 0x0002, 0x26b2: 0x0002, 0x26b3: 0x0002, 0x26b4: 0x0002, 0x26b5: 0x0002, + 0x26b6: 0x0002, 0x26b7: 0x0002, 0x26b8: 0x0002, 0x26b9: 0x0002, 0x26ba: 0x0002, 0x26bb: 0x0002, + // Block 0x9b, offset 0x26c0 + 0x26f6: 0x000c, 0x26f7: 0x000c, 0x26f8: 0x000c, 0x26f9: 0x000c, 0x26fa: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2700: 0x0001, 0x2701: 0x0001, 0x2702: 0x0001, 0x2703: 0x0001, 0x2704: 0x0001, 0x2705: 0x0001, + 0x2706: 0x0001, 0x2707: 0x0001, 0x2708: 0x0001, 0x2709: 0x0001, 0x270a: 0x0001, 0x270b: 0x0001, + 0x270c: 0x0001, 0x270d: 0x0001, 0x270e: 0x0001, 0x270f: 0x0001, 0x2710: 0x0001, 0x2711: 0x0001, + 0x2712: 0x0001, 0x2713: 0x0001, 0x2714: 0x0001, 0x2715: 0x0001, 0x2716: 0x0001, 0x2717: 0x0001, + 0x2718: 0x0001, 0x2719: 0x0001, 0x271a: 0x0001, 0x271b: 0x0001, 0x271c: 0x0001, 0x271d: 0x0001, + 0x271e: 0x0001, 0x271f: 0x0001, 0x2720: 0x0001, 0x2721: 0x0001, 0x2722: 0x0001, 0x2723: 0x0001, + 0x2724: 0x0001, 0x2725: 0x0001, 0x2726: 0x0001, 0x2727: 0x0001, 0x2728: 0x0001, 0x2729: 0x0001, + 0x272a: 0x0001, 0x272b: 0x0001, 0x272c: 0x0001, 0x272d: 0x0001, 0x272e: 0x0001, 0x272f: 0x0001, + 0x2730: 0x0001, 0x2731: 0x0001, 0x2732: 0x0001, 0x2733: 0x0001, 0x2734: 0x0001, 0x2735: 0x0001, + 0x2736: 0x0001, 0x2737: 0x0001, 0x2738: 0x0001, 0x2739: 0x0001, 0x273a: 0x0001, 0x273b: 0x0001, + 0x273c: 0x0001, 0x273d: 0x0001, 0x273e: 0x0001, 0x273f: 0x0001, + // Block 0x9d, offset 0x2740 + 0x2740: 0x0001, 0x2741: 0x0001, 0x2742: 0x0001, 0x2743: 0x0001, 0x2744: 0x0001, 0x2745: 0x0001, + 0x2746: 0x0001, 0x2747: 0x0001, 0x2748: 0x0001, 0x2749: 0x0001, 0x274a: 0x0001, 0x274b: 0x0001, + 0x274c: 0x0001, 0x274d: 0x0001, 0x274e: 0x0001, 0x274f: 0x0001, 0x2750: 0x0001, 0x2751: 0x0001, + 0x2752: 0x0001, 0x2753: 0x0001, 0x2754: 0x0001, 0x2755: 0x0001, 0x2756: 0x0001, 0x2757: 0x0001, + 0x2758: 0x0001, 0x2759: 0x0001, 0x275a: 0x0001, 0x275b: 0x0001, 0x275c: 0x0001, 0x275d: 0x0001, + 0x275e: 0x0001, 0x275f: 0x000a, 0x2760: 0x0001, 0x2761: 0x0001, 0x2762: 0x0001, 0x2763: 0x0001, + 0x2764: 0x0001, 0x2765: 0x0001, 0x2766: 0x0001, 0x2767: 0x0001, 0x2768: 0x0001, 0x2769: 0x0001, + 0x276a: 0x0001, 0x276b: 0x0001, 0x276c: 0x0001, 0x276d: 0x0001, 0x276e: 0x0001, 0x276f: 0x0001, + 0x2770: 0x0001, 0x2771: 0x0001, 0x2772: 0x0001, 0x2773: 0x0001, 0x2774: 0x0001, 0x2775: 0x0001, + 0x2776: 0x0001, 0x2777: 0x0001, 0x2778: 0x0001, 0x2779: 0x0001, 0x277a: 0x0001, 0x277b: 0x0001, + 0x277c: 0x0001, 0x277d: 0x0001, 0x277e: 0x0001, 0x277f: 0x0001, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x000c, 0x2782: 0x000c, 0x2783: 0x000c, 0x2784: 0x0001, 0x2785: 0x000c, + 0x2786: 0x000c, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x000c, 0x278d: 0x000c, 0x278e: 0x000c, 0x278f: 0x000c, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x000c, 0x27b9: 0x000c, 0x27ba: 0x000c, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x000c, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x0001, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x000c, 0x27e6: 0x000c, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x0001, 0x2802: 0x0001, 0x2803: 0x0001, 0x2804: 0x0001, 0x2805: 0x0001, + 0x2806: 0x0001, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x0001, 0x280d: 0x0001, 0x280e: 0x0001, 0x280f: 0x0001, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x0001, 0x2839: 0x000a, 0x283a: 0x000a, 0x283b: 0x000a, + 0x283c: 0x000a, 0x283d: 0x000a, 0x283e: 0x000a, 0x283f: 0x000a, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0005, 0x2861: 0x0005, 0x2862: 0x0005, 0x2863: 0x0005, + 0x2864: 0x0005, 0x2865: 0x0005, 0x2866: 0x0005, 0x2867: 0x0005, 0x2868: 0x0005, 0x2869: 0x0005, + 0x286a: 0x0005, 0x286b: 0x0005, 0x286c: 0x0005, 0x286d: 0x0005, 0x286e: 0x0005, 0x286f: 0x0005, + 0x2870: 0x0005, 0x2871: 0x0005, 0x2872: 0x0005, 0x2873: 0x0005, 0x2874: 0x0005, 0x2875: 0x0005, + 0x2876: 0x0005, 0x2877: 0x0005, 0x2878: 0x0005, 0x2879: 0x0005, 0x287a: 0x0005, 0x287b: 0x0005, + 0x287c: 0x0005, 0x287d: 0x0005, 0x287e: 0x0005, 0x287f: 0x0001, + // Block 0xa2, offset 0x2880 + 0x2881: 0x000c, + 0x28b8: 0x000c, 0x28b9: 0x000c, 0x28ba: 0x000c, 0x28bb: 0x000c, + 0x28bc: 0x000c, 0x28bd: 0x000c, 0x28be: 0x000c, 0x28bf: 0x000c, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x000c, 0x28c1: 0x000c, 0x28c2: 0x000c, 0x28c3: 0x000c, 0x28c4: 0x000c, 0x28c5: 0x000c, + 0x28c6: 0x000c, + 0x28d2: 0x000a, 0x28d3: 0x000a, 0x28d4: 0x000a, 0x28d5: 0x000a, 0x28d6: 0x000a, 0x28d7: 0x000a, + 0x28d8: 0x000a, 0x28d9: 0x000a, 0x28da: 0x000a, 0x28db: 0x000a, 0x28dc: 0x000a, 0x28dd: 0x000a, + 0x28de: 0x000a, 0x28df: 0x000a, 0x28e0: 0x000a, 0x28e1: 0x000a, 0x28e2: 0x000a, 0x28e3: 0x000a, + 0x28e4: 0x000a, 0x28e5: 0x000a, + 0x28ff: 0x000c, + // Block 0xa4, offset 0x2900 + 0x2900: 0x000c, 0x2901: 0x000c, + 0x2933: 0x000c, 0x2934: 0x000c, 0x2935: 0x000c, + 0x2936: 0x000c, 0x2939: 0x000c, 0x293a: 0x000c, + // Block 0xa5, offset 0x2940 + 0x2940: 0x000c, 0x2941: 0x000c, 0x2942: 0x000c, + 0x2967: 0x000c, 0x2968: 0x000c, 0x2969: 0x000c, + 0x296a: 0x000c, 0x296b: 0x000c, 0x296d: 0x000c, 0x296e: 0x000c, 0x296f: 0x000c, + 0x2970: 0x000c, 0x2971: 0x000c, 0x2972: 0x000c, 0x2973: 0x000c, 0x2974: 0x000c, + // Block 0xa6, offset 0x2980 + 0x29b3: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x000c, 0x29c1: 0x000c, + 0x29f6: 0x000c, 0x29f7: 0x000c, 0x29f8: 0x000c, 0x29f9: 0x000c, 0x29fa: 0x000c, 0x29fb: 0x000c, + 0x29fc: 0x000c, 0x29fd: 0x000c, 0x29fe: 0x000c, + // Block 0xa8, offset 0x2a00 + 0x2a0a: 0x000c, 0x2a0b: 0x000c, + 0x2a0c: 0x000c, + // Block 0xa9, offset 0x2a40 + 0x2a6f: 0x000c, + 0x2a70: 0x000c, 0x2a71: 0x000c, 0x2a74: 0x000c, + 0x2a76: 0x000c, 0x2a77: 0x000c, + 0x2a7e: 0x000c, + // Block 0xaa, offset 0x2a80 + 0x2a9f: 0x000c, 0x2aa3: 0x000c, + 0x2aa4: 0x000c, 0x2aa5: 0x000c, 0x2aa6: 0x000c, 0x2aa7: 0x000c, 0x2aa8: 0x000c, 0x2aa9: 0x000c, + 0x2aaa: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x000c, 0x2ac1: 0x000c, + 0x2afc: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, + 0x2b26: 0x000c, 0x2b27: 0x000c, 0x2b28: 0x000c, 0x2b29: 0x000c, + 0x2b2a: 0x000c, 0x2b2b: 0x000c, 0x2b2c: 0x000c, + 0x2b30: 0x000c, 0x2b31: 0x000c, 0x2b32: 0x000c, 0x2b33: 0x000c, 0x2b34: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b78: 0x000c, 0x2b79: 0x000c, 0x2b7a: 0x000c, 0x2b7b: 0x000c, + 0x2b7c: 0x000c, 0x2b7d: 0x000c, 0x2b7e: 0x000c, 0x2b7f: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2b82: 0x000c, 0x2b83: 0x000c, 0x2b84: 0x000c, + 0x2b86: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bf3: 0x000c, 0x2bf4: 0x000c, 0x2bf5: 0x000c, + 0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bfa: 0x000c, + 0x2bff: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c00: 0x000c, 0x2c02: 0x000c, 0x2c03: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c72: 0x000c, 0x2c73: 0x000c, 0x2c74: 0x000c, 0x2c75: 0x000c, + 0x2c7c: 0x000c, 0x2c7d: 0x000c, 0x2c7f: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c80: 0x000c, + 0x2c9c: 0x000c, 0x2c9d: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cf3: 0x000c, 0x2cf4: 0x000c, 0x2cf5: 0x000c, + 0x2cf6: 0x000c, 0x2cf7: 0x000c, 0x2cf8: 0x000c, 0x2cf9: 0x000c, 0x2cfa: 0x000c, + 0x2cfd: 0x000c, 0x2cff: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d00: 0x000c, + 0x2d20: 0x000a, 0x2d21: 0x000a, 0x2d22: 0x000a, 0x2d23: 0x000a, + 0x2d24: 0x000a, 0x2d25: 0x000a, 0x2d26: 0x000a, 0x2d27: 0x000a, 0x2d28: 0x000a, 0x2d29: 0x000a, + 0x2d2a: 0x000a, 0x2d2b: 0x000a, 0x2d2c: 0x000a, + // Block 0xb5, offset 0x2d40 + 0x2d6b: 0x000c, 0x2d6d: 0x000c, + 0x2d70: 0x000c, 0x2d71: 0x000c, 0x2d72: 0x000c, 0x2d73: 0x000c, 0x2d74: 0x000c, 0x2d75: 0x000c, + 0x2d77: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2d9d: 0x000c, + 0x2d9e: 0x000c, 0x2d9f: 0x000c, 0x2da2: 0x000c, 0x2da3: 0x000c, + 0x2da4: 0x000c, 0x2da5: 0x000c, 0x2da7: 0x000c, 0x2da8: 0x000c, 0x2da9: 0x000c, + 0x2daa: 0x000c, 0x2dab: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2dc1: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c, 0x2dc4: 0x000c, 0x2dc5: 0x000c, + 0x2dc6: 0x000c, 0x2dc9: 0x000c, 0x2dca: 0x000c, + 0x2df3: 0x000c, 0x2df4: 0x000c, 0x2df5: 0x000c, + 0x2df6: 0x000c, 0x2df7: 0x000c, 0x2df8: 0x000c, 0x2dfb: 0x000c, + 0x2dfc: 0x000c, 0x2dfd: 0x000c, 0x2dfe: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e07: 0x000c, + 0x2e11: 0x000c, + 0x2e12: 0x000c, 0x2e13: 0x000c, 0x2e14: 0x000c, 0x2e15: 0x000c, 0x2e16: 0x000c, + 0x2e19: 0x000c, 0x2e1a: 0x000c, 0x2e1b: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e4a: 0x000c, 0x2e4b: 0x000c, + 0x2e4c: 0x000c, 0x2e4d: 0x000c, 0x2e4e: 0x000c, 0x2e4f: 0x000c, 0x2e50: 0x000c, 0x2e51: 0x000c, + 0x2e52: 0x000c, 0x2e53: 0x000c, 0x2e54: 0x000c, 0x2e55: 0x000c, 0x2e56: 0x000c, + 0x2e58: 0x000c, 0x2e59: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb0: 0x000c, 0x2eb1: 0x000c, 0x2eb2: 0x000c, 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c, 0x2ebb: 0x000c, + 0x2ebc: 0x000c, 0x2ebd: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ed2: 0x000c, 0x2ed3: 0x000c, 0x2ed4: 0x000c, 0x2ed5: 0x000c, 0x2ed6: 0x000c, 0x2ed7: 0x000c, + 0x2ed8: 0x000c, 0x2ed9: 0x000c, 0x2eda: 0x000c, 0x2edb: 0x000c, 0x2edc: 0x000c, 0x2edd: 0x000c, + 0x2ede: 0x000c, 0x2edf: 0x000c, 0x2ee0: 0x000c, 0x2ee1: 0x000c, 0x2ee2: 0x000c, 0x2ee3: 0x000c, + 0x2ee4: 0x000c, 0x2ee5: 0x000c, 0x2ee6: 0x000c, 0x2ee7: 0x000c, + 0x2eea: 0x000c, 0x2eeb: 0x000c, 0x2eec: 0x000c, 0x2eed: 0x000c, 0x2eee: 0x000c, 0x2eef: 0x000c, + 0x2ef0: 0x000c, 0x2ef2: 0x000c, 0x2ef3: 0x000c, 0x2ef5: 0x000c, + 0x2ef6: 0x000c, + // Block 0xbc, offset 0x2f00 + 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c, + 0x2f36: 0x000c, 0x2f3a: 0x000c, + 0x2f3c: 0x000c, 0x2f3d: 0x000c, 0x2f3f: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f40: 0x000c, 0x2f41: 0x000c, 0x2f42: 0x000c, 0x2f43: 0x000c, 0x2f44: 0x000c, 0x2f45: 0x000c, + 0x2f47: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ff0: 0x000c, 0x2ff1: 0x000c, 0x2ff2: 0x000c, 0x2ff3: 0x000c, 0x2ff4: 0x000c, 0x2ff5: 0x000c, + 0x2ff6: 0x000c, + // Block 0xc0, offset 0x3000 + 0x300f: 0x000c, 0x3010: 0x000c, 0x3011: 0x000c, + 0x3012: 0x000c, + // Block 0xc1, offset 0x3040 + 0x305d: 0x000c, + 0x305e: 0x000c, 0x3060: 0x000b, 0x3061: 0x000b, 0x3062: 0x000b, 0x3063: 0x000b, + // Block 0xc2, offset 0x3080 + 0x30a7: 0x000c, 0x30a8: 0x000c, 0x30a9: 0x000c, + 0x30b3: 0x000b, 0x30b4: 0x000b, 0x30b5: 0x000b, + 0x30b6: 0x000b, 0x30b7: 0x000b, 0x30b8: 0x000b, 0x30b9: 0x000b, 0x30ba: 0x000b, 0x30bb: 0x000c, + 0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c, 0x30bf: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30c0: 0x000c, 0x30c1: 0x000c, 0x30c2: 0x000c, 0x30c5: 0x000c, + 0x30c6: 0x000c, 0x30c7: 0x000c, 0x30c8: 0x000c, 0x30c9: 0x000c, 0x30ca: 0x000c, 0x30cb: 0x000c, + 0x30ea: 0x000c, 0x30eb: 0x000c, 0x30ec: 0x000c, 0x30ed: 0x000c, + // Block 0xc4, offset 0x3100 + 0x3100: 0x000a, 0x3101: 0x000a, 0x3102: 0x000c, 0x3103: 0x000c, 0x3104: 0x000c, 0x3105: 0x000a, + // Block 0xc5, offset 0x3140 + 0x3140: 0x000a, 0x3141: 0x000a, 0x3142: 0x000a, 0x3143: 0x000a, 0x3144: 0x000a, 0x3145: 0x000a, + 0x3146: 0x000a, 0x3147: 0x000a, 0x3148: 0x000a, 0x3149: 0x000a, 0x314a: 0x000a, 0x314b: 0x000a, + 0x314c: 0x000a, 0x314d: 0x000a, 0x314e: 0x000a, 0x314f: 0x000a, 0x3150: 0x000a, 0x3151: 0x000a, + 0x3152: 0x000a, 0x3153: 0x000a, 0x3154: 0x000a, 0x3155: 0x000a, 0x3156: 0x000a, + // Block 0xc6, offset 0x3180 + 0x319b: 0x000a, + // Block 0xc7, offset 0x31c0 + 0x31d5: 0x000a, + // Block 0xc8, offset 0x3200 + 0x320f: 0x000a, + // Block 0xc9, offset 0x3240 + 0x3249: 0x000a, + // Block 0xca, offset 0x3280 + 0x3283: 0x000a, + 0x328e: 0x0002, 0x328f: 0x0002, 0x3290: 0x0002, 0x3291: 0x0002, + 0x3292: 0x0002, 0x3293: 0x0002, 0x3294: 0x0002, 0x3295: 0x0002, 0x3296: 0x0002, 0x3297: 0x0002, + 0x3298: 0x0002, 0x3299: 0x0002, 0x329a: 0x0002, 0x329b: 0x0002, 0x329c: 0x0002, 0x329d: 0x0002, + 0x329e: 0x0002, 0x329f: 0x0002, 0x32a0: 0x0002, 0x32a1: 0x0002, 0x32a2: 0x0002, 0x32a3: 0x0002, + 0x32a4: 0x0002, 0x32a5: 0x0002, 0x32a6: 0x0002, 0x32a7: 0x0002, 0x32a8: 0x0002, 0x32a9: 0x0002, + 0x32aa: 0x0002, 0x32ab: 0x0002, 0x32ac: 0x0002, 0x32ad: 0x0002, 0x32ae: 0x0002, 0x32af: 0x0002, + 0x32b0: 0x0002, 0x32b1: 0x0002, 0x32b2: 0x0002, 0x32b3: 0x0002, 0x32b4: 0x0002, 0x32b5: 0x0002, + 0x32b6: 0x0002, 0x32b7: 0x0002, 0x32b8: 0x0002, 0x32b9: 0x0002, 0x32ba: 0x0002, 0x32bb: 0x0002, + 0x32bc: 0x0002, 0x32bd: 0x0002, 0x32be: 0x0002, 0x32bf: 0x0002, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x000c, 0x32c1: 0x000c, 0x32c2: 0x000c, 0x32c3: 0x000c, 0x32c4: 0x000c, 0x32c5: 0x000c, + 0x32c6: 0x000c, 0x32c7: 0x000c, 0x32c8: 0x000c, 0x32c9: 0x000c, 0x32ca: 0x000c, 0x32cb: 0x000c, + 0x32cc: 0x000c, 0x32cd: 0x000c, 0x32ce: 0x000c, 0x32cf: 0x000c, 0x32d0: 0x000c, 0x32d1: 0x000c, + 0x32d2: 0x000c, 0x32d3: 0x000c, 0x32d4: 0x000c, 0x32d5: 0x000c, 0x32d6: 0x000c, 0x32d7: 0x000c, + 0x32d8: 0x000c, 0x32d9: 0x000c, 0x32da: 0x000c, 0x32db: 0x000c, 0x32dc: 0x000c, 0x32dd: 0x000c, + 0x32de: 0x000c, 0x32df: 0x000c, 0x32e0: 0x000c, 0x32e1: 0x000c, 0x32e2: 0x000c, 0x32e3: 0x000c, + 0x32e4: 0x000c, 0x32e5: 0x000c, 0x32e6: 0x000c, 0x32e7: 0x000c, 0x32e8: 0x000c, 0x32e9: 0x000c, + 0x32ea: 0x000c, 0x32eb: 0x000c, 0x32ec: 0x000c, 0x32ed: 0x000c, 0x32ee: 0x000c, 0x32ef: 0x000c, + 0x32f0: 0x000c, 0x32f1: 0x000c, 0x32f2: 0x000c, 0x32f3: 0x000c, 0x32f4: 0x000c, 0x32f5: 0x000c, + 0x32f6: 0x000c, 0x32fb: 0x000c, + 0x32fc: 0x000c, 0x32fd: 0x000c, 0x32fe: 0x000c, 0x32ff: 0x000c, + // Block 0xcc, offset 0x3300 + 0x3300: 0x000c, 0x3301: 0x000c, 0x3302: 0x000c, 0x3303: 0x000c, 0x3304: 0x000c, 0x3305: 0x000c, + 0x3306: 0x000c, 0x3307: 0x000c, 0x3308: 0x000c, 0x3309: 0x000c, 0x330a: 0x000c, 0x330b: 0x000c, + 0x330c: 0x000c, 0x330d: 0x000c, 0x330e: 0x000c, 0x330f: 0x000c, 0x3310: 0x000c, 0x3311: 0x000c, + 0x3312: 0x000c, 0x3313: 0x000c, 0x3314: 0x000c, 0x3315: 0x000c, 0x3316: 0x000c, 0x3317: 0x000c, + 0x3318: 0x000c, 0x3319: 0x000c, 0x331a: 0x000c, 0x331b: 0x000c, 0x331c: 0x000c, 0x331d: 0x000c, + 0x331e: 0x000c, 0x331f: 0x000c, 0x3320: 0x000c, 0x3321: 0x000c, 0x3322: 0x000c, 0x3323: 0x000c, + 0x3324: 0x000c, 0x3325: 0x000c, 0x3326: 0x000c, 0x3327: 0x000c, 0x3328: 0x000c, 0x3329: 0x000c, + 0x332a: 0x000c, 0x332b: 0x000c, 0x332c: 0x000c, + 0x3335: 0x000c, + // Block 0xcd, offset 0x3340 + 0x3344: 0x000c, + 0x335b: 0x000c, 0x335c: 0x000c, 0x335d: 0x000c, + 0x335e: 0x000c, 0x335f: 0x000c, 0x3361: 0x000c, 0x3362: 0x000c, 0x3363: 0x000c, + 0x3364: 0x000c, 0x3365: 0x000c, 0x3366: 0x000c, 0x3367: 0x000c, 0x3368: 0x000c, 0x3369: 0x000c, + 0x336a: 0x000c, 0x336b: 0x000c, 0x336c: 0x000c, 0x336d: 0x000c, 0x336e: 0x000c, 0x336f: 0x000c, + // Block 0xce, offset 0x3380 + 0x3380: 0x000c, 0x3381: 0x000c, 0x3382: 0x000c, 0x3383: 0x000c, 0x3384: 0x000c, 0x3385: 0x000c, + 0x3386: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c, + 0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c, + 0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c, 0x3396: 0x000c, 0x3397: 0x000c, + 0x3398: 0x000c, 0x339b: 0x000c, 0x339c: 0x000c, 0x339d: 0x000c, + 0x339e: 0x000c, 0x339f: 0x000c, 0x33a0: 0x000c, 0x33a1: 0x000c, 0x33a3: 0x000c, + 0x33a4: 0x000c, 0x33a6: 0x000c, 0x33a7: 0x000c, 0x33a8: 0x000c, 0x33a9: 0x000c, + 0x33aa: 0x000c, + // Block 0xcf, offset 0x33c0 + 0x33c0: 0x0001, 0x33c1: 0x0001, 0x33c2: 0x0001, 0x33c3: 0x0001, 0x33c4: 0x0001, 0x33c5: 0x0001, + 0x33c6: 0x0001, 0x33c7: 0x0001, 0x33c8: 0x0001, 0x33c9: 0x0001, 0x33ca: 0x0001, 0x33cb: 0x0001, + 0x33cc: 0x0001, 0x33cd: 0x0001, 0x33ce: 0x0001, 0x33cf: 0x0001, 0x33d0: 0x000c, 0x33d1: 0x000c, + 0x33d2: 0x000c, 0x33d3: 0x000c, 0x33d4: 0x000c, 0x33d5: 0x000c, 0x33d6: 0x000c, 0x33d7: 0x0001, + 0x33d8: 0x0001, 0x33d9: 0x0001, 0x33da: 0x0001, 0x33db: 0x0001, 0x33dc: 0x0001, 0x33dd: 0x0001, + 0x33de: 0x0001, 0x33df: 0x0001, 0x33e0: 0x0001, 0x33e1: 0x0001, 0x33e2: 0x0001, 0x33e3: 0x0001, + 0x33e4: 0x0001, 0x33e5: 0x0001, 0x33e6: 0x0001, 0x33e7: 0x0001, 0x33e8: 0x0001, 0x33e9: 0x0001, + 0x33ea: 0x0001, 0x33eb: 0x0001, 0x33ec: 0x0001, 0x33ed: 0x0001, 0x33ee: 0x0001, 0x33ef: 0x0001, + 0x33f0: 0x0001, 0x33f1: 0x0001, 0x33f2: 0x0001, 0x33f3: 0x0001, 0x33f4: 0x0001, 0x33f5: 0x0001, + 0x33f6: 0x0001, 0x33f7: 0x0001, 0x33f8: 0x0001, 0x33f9: 0x0001, 0x33fa: 0x0001, 0x33fb: 0x0001, + 0x33fc: 0x0001, 0x33fd: 0x0001, 0x33fe: 0x0001, 0x33ff: 0x0001, + // Block 0xd0, offset 0x3400 + 0x3400: 0x0001, 0x3401: 0x0001, 0x3402: 0x0001, 0x3403: 0x0001, 0x3404: 0x000c, 0x3405: 0x000c, + 0x3406: 0x000c, 0x3407: 0x000c, 0x3408: 0x000c, 0x3409: 0x000c, 0x340a: 0x000c, 0x340b: 0x0001, + 0x340c: 0x0001, 0x340d: 0x0001, 0x340e: 0x0001, 0x340f: 0x0001, 0x3410: 0x0001, 0x3411: 0x0001, + 0x3412: 0x0001, 0x3413: 0x0001, 0x3414: 0x0001, 0x3415: 0x0001, 0x3416: 0x0001, 0x3417: 0x0001, + 0x3418: 0x0001, 0x3419: 0x0001, 0x341a: 0x0001, 0x341b: 0x0001, 0x341c: 0x0001, 0x341d: 0x0001, + 0x341e: 0x0001, 0x341f: 0x0001, 0x3420: 0x0001, 0x3421: 0x0001, 0x3422: 0x0001, 0x3423: 0x0001, + 0x3424: 0x0001, 0x3425: 0x0001, 0x3426: 0x0001, 0x3427: 0x0001, 0x3428: 0x0001, 0x3429: 0x0001, + 0x342a: 0x0001, 0x342b: 0x0001, 0x342c: 0x0001, 0x342d: 0x0001, 0x342e: 0x0001, 0x342f: 0x0001, + 0x3430: 0x0001, 0x3431: 0x0001, 0x3432: 0x0001, 0x3433: 0x0001, 0x3434: 0x0001, 0x3435: 0x0001, + 0x3436: 0x0001, 0x3437: 0x0001, 0x3438: 0x0001, 0x3439: 0x0001, 0x343a: 0x0001, 0x343b: 0x0001, + 0x343c: 0x0001, 0x343d: 0x0001, 0x343e: 0x0001, 0x343f: 0x0001, + // Block 0xd1, offset 0x3440 + 0x3440: 0x000d, 0x3441: 0x000d, 0x3442: 0x000d, 0x3443: 0x000d, 0x3444: 0x000d, 0x3445: 0x000d, + 0x3446: 0x000d, 0x3447: 0x000d, 0x3448: 0x000d, 0x3449: 0x000d, 0x344a: 0x000d, 0x344b: 0x000d, + 0x344c: 0x000d, 0x344d: 0x000d, 0x344e: 0x000d, 0x344f: 0x000d, 0x3450: 0x000d, 0x3451: 0x000d, + 0x3452: 0x000d, 0x3453: 0x000d, 0x3454: 0x000d, 0x3455: 0x000d, 0x3456: 0x000d, 0x3457: 0x000d, + 0x3458: 0x000d, 0x3459: 0x000d, 0x345a: 0x000d, 0x345b: 0x000d, 0x345c: 0x000d, 0x345d: 0x000d, + 0x345e: 0x000d, 0x345f: 0x000d, 0x3460: 0x000d, 0x3461: 0x000d, 0x3462: 0x000d, 0x3463: 0x000d, + 0x3464: 0x000d, 0x3465: 0x000d, 0x3466: 0x000d, 0x3467: 0x000d, 0x3468: 0x000d, 0x3469: 0x000d, + 0x346a: 0x000d, 0x346b: 0x000d, 0x346c: 0x000d, 0x346d: 0x000d, 0x346e: 0x000d, 0x346f: 0x000d, + 0x3470: 0x000a, 0x3471: 0x000a, 0x3472: 0x000d, 0x3473: 0x000d, 0x3474: 0x000d, 0x3475: 0x000d, + 0x3476: 0x000d, 0x3477: 0x000d, 0x3478: 0x000d, 0x3479: 0x000d, 0x347a: 0x000d, 0x347b: 0x000d, + 0x347c: 0x000d, 0x347d: 0x000d, 0x347e: 0x000d, 0x347f: 0x000d, + // Block 0xd2, offset 0x3480 + 0x3480: 0x000a, 0x3481: 0x000a, 0x3482: 0x000a, 0x3483: 0x000a, 0x3484: 0x000a, 0x3485: 0x000a, + 0x3486: 0x000a, 0x3487: 0x000a, 0x3488: 0x000a, 0x3489: 0x000a, 0x348a: 0x000a, 0x348b: 0x000a, + 0x348c: 0x000a, 0x348d: 0x000a, 0x348e: 0x000a, 0x348f: 0x000a, 0x3490: 0x000a, 0x3491: 0x000a, + 0x3492: 0x000a, 0x3493: 0x000a, 0x3494: 0x000a, 0x3495: 0x000a, 0x3496: 0x000a, 0x3497: 0x000a, + 0x3498: 0x000a, 0x3499: 0x000a, 0x349a: 0x000a, 0x349b: 0x000a, 0x349c: 0x000a, 0x349d: 0x000a, + 0x349e: 0x000a, 0x349f: 0x000a, 0x34a0: 0x000a, 0x34a1: 0x000a, 0x34a2: 0x000a, 0x34a3: 0x000a, + 0x34a4: 0x000a, 0x34a5: 0x000a, 0x34a6: 0x000a, 0x34a7: 0x000a, 0x34a8: 0x000a, 0x34a9: 0x000a, + 0x34aa: 0x000a, 0x34ab: 0x000a, + 0x34b0: 0x000a, 0x34b1: 0x000a, 0x34b2: 0x000a, 0x34b3: 0x000a, 0x34b4: 0x000a, 0x34b5: 0x000a, + 0x34b6: 0x000a, 0x34b7: 0x000a, 0x34b8: 0x000a, 0x34b9: 0x000a, 0x34ba: 0x000a, 0x34bb: 0x000a, + 0x34bc: 0x000a, 0x34bd: 0x000a, 0x34be: 0x000a, 0x34bf: 0x000a, + // Block 0xd3, offset 0x34c0 + 0x34c0: 0x000a, 0x34c1: 0x000a, 0x34c2: 0x000a, 0x34c3: 0x000a, 0x34c4: 0x000a, 0x34c5: 0x000a, + 0x34c6: 0x000a, 0x34c7: 0x000a, 0x34c8: 0x000a, 0x34c9: 0x000a, 0x34ca: 0x000a, 0x34cb: 0x000a, + 0x34cc: 0x000a, 0x34cd: 0x000a, 0x34ce: 0x000a, 0x34cf: 0x000a, 0x34d0: 0x000a, 0x34d1: 0x000a, + 0x34d2: 0x000a, 0x34d3: 0x000a, + 0x34e0: 0x000a, 0x34e1: 0x000a, 0x34e2: 0x000a, 0x34e3: 0x000a, + 0x34e4: 0x000a, 0x34e5: 0x000a, 0x34e6: 0x000a, 0x34e7: 0x000a, 0x34e8: 0x000a, 0x34e9: 0x000a, + 0x34ea: 0x000a, 0x34eb: 0x000a, 0x34ec: 0x000a, 0x34ed: 0x000a, 0x34ee: 0x000a, + 0x34f1: 0x000a, 0x34f2: 0x000a, 0x34f3: 0x000a, 0x34f4: 0x000a, 0x34f5: 0x000a, + 0x34f6: 0x000a, 0x34f7: 0x000a, 0x34f8: 0x000a, 0x34f9: 0x000a, 0x34fa: 0x000a, 0x34fb: 0x000a, + 0x34fc: 0x000a, 0x34fd: 0x000a, 0x34fe: 0x000a, 0x34ff: 0x000a, + // Block 0xd4, offset 0x3500 + 0x3501: 0x000a, 0x3502: 0x000a, 0x3503: 0x000a, 0x3504: 0x000a, 0x3505: 0x000a, + 0x3506: 0x000a, 0x3507: 0x000a, 0x3508: 0x000a, 0x3509: 0x000a, 0x350a: 0x000a, 0x350b: 0x000a, + 0x350c: 0x000a, 0x350d: 0x000a, 0x350e: 0x000a, 0x350f: 0x000a, 0x3511: 0x000a, + 0x3512: 0x000a, 0x3513: 0x000a, 0x3514: 0x000a, 0x3515: 0x000a, 0x3516: 0x000a, 0x3517: 0x000a, + 0x3518: 0x000a, 0x3519: 0x000a, 0x351a: 0x000a, 0x351b: 0x000a, 0x351c: 0x000a, 0x351d: 0x000a, + 0x351e: 0x000a, 0x351f: 0x000a, 0x3520: 0x000a, 0x3521: 0x000a, 0x3522: 0x000a, 0x3523: 0x000a, + 0x3524: 0x000a, 0x3525: 0x000a, 0x3526: 0x000a, 0x3527: 0x000a, 0x3528: 0x000a, 0x3529: 0x000a, + 0x352a: 0x000a, 0x352b: 0x000a, 0x352c: 0x000a, 0x352d: 0x000a, 0x352e: 0x000a, 0x352f: 0x000a, + 0x3530: 0x000a, 0x3531: 0x000a, 0x3532: 0x000a, 0x3533: 0x000a, 0x3534: 0x000a, 0x3535: 0x000a, + // Block 0xd5, offset 0x3540 + 0x3540: 0x0002, 0x3541: 0x0002, 0x3542: 0x0002, 0x3543: 0x0002, 0x3544: 0x0002, 0x3545: 0x0002, + 0x3546: 0x0002, 0x3547: 0x0002, 0x3548: 0x0002, 0x3549: 0x0002, 0x354a: 0x0002, 0x354b: 0x000a, + 0x354c: 0x000a, + // Block 0xd6, offset 0x3580 + 0x35aa: 0x000a, 0x35ab: 0x000a, + // Block 0xd7, offset 0x35c0 + 0x35e0: 0x000a, 0x35e1: 0x000a, 0x35e2: 0x000a, 0x35e3: 0x000a, + 0x35e4: 0x000a, 0x35e5: 0x000a, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000a, 0x3601: 0x000a, 0x3602: 0x000a, 0x3603: 0x000a, 0x3604: 0x000a, 0x3605: 0x000a, + 0x3606: 0x000a, 0x3607: 0x000a, 0x3608: 0x000a, 0x3609: 0x000a, 0x360a: 0x000a, 0x360b: 0x000a, + 0x360c: 0x000a, 0x360d: 0x000a, 0x360e: 0x000a, 0x360f: 0x000a, 0x3610: 0x000a, 0x3611: 0x000a, + 0x3612: 0x000a, 0x3613: 0x000a, 0x3614: 0x000a, + 0x3620: 0x000a, 0x3621: 0x000a, 0x3622: 0x000a, 0x3623: 0x000a, + 0x3624: 0x000a, 0x3625: 0x000a, 0x3626: 0x000a, 0x3627: 0x000a, 0x3628: 0x000a, 0x3629: 0x000a, + 0x362a: 0x000a, 0x362b: 0x000a, 0x362c: 0x000a, + 0x3630: 0x000a, 0x3631: 0x000a, 0x3632: 0x000a, 0x3633: 0x000a, 0x3634: 0x000a, 0x3635: 0x000a, + 0x3636: 0x000a, 0x3637: 0x000a, 0x3638: 0x000a, + // Block 0xd9, offset 0x3640 + 0x3640: 0x000a, 0x3641: 0x000a, 0x3642: 0x000a, 0x3643: 0x000a, 0x3644: 0x000a, 0x3645: 0x000a, + 0x3646: 0x000a, 0x3647: 0x000a, 0x3648: 0x000a, 0x3649: 0x000a, 0x364a: 0x000a, 0x364b: 0x000a, + 0x364c: 0x000a, 0x364d: 0x000a, 0x364e: 0x000a, 0x364f: 0x000a, 0x3650: 0x000a, 0x3651: 0x000a, + 0x3652: 0x000a, 0x3653: 0x000a, 0x3654: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000a, 0x3683: 0x000a, 0x3684: 0x000a, 0x3685: 0x000a, + 0x3686: 0x000a, 0x3687: 0x000a, 0x3688: 0x000a, 0x3689: 0x000a, 0x368a: 0x000a, 0x368b: 0x000a, + 0x3690: 0x000a, 0x3691: 0x000a, + 0x3692: 0x000a, 0x3693: 0x000a, 0x3694: 0x000a, 0x3695: 0x000a, 0x3696: 0x000a, 0x3697: 0x000a, + 0x3698: 0x000a, 0x3699: 0x000a, 0x369a: 0x000a, 0x369b: 0x000a, 0x369c: 0x000a, 0x369d: 0x000a, + 0x369e: 0x000a, 0x369f: 0x000a, 0x36a0: 0x000a, 0x36a1: 0x000a, 0x36a2: 0x000a, 0x36a3: 0x000a, + 0x36a4: 0x000a, 0x36a5: 0x000a, 0x36a6: 0x000a, 0x36a7: 0x000a, 0x36a8: 0x000a, 0x36a9: 0x000a, + 0x36aa: 0x000a, 0x36ab: 0x000a, 0x36ac: 0x000a, 0x36ad: 0x000a, 0x36ae: 0x000a, 0x36af: 0x000a, + 0x36b0: 0x000a, 0x36b1: 0x000a, 0x36b2: 0x000a, 0x36b3: 0x000a, 0x36b4: 0x000a, 0x36b5: 0x000a, + 0x36b6: 0x000a, 0x36b7: 0x000a, 0x36b8: 0x000a, 0x36b9: 0x000a, 0x36ba: 0x000a, 0x36bb: 0x000a, + 0x36bc: 0x000a, 0x36bd: 0x000a, 0x36be: 0x000a, 0x36bf: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a, + 0x36c6: 0x000a, 0x36c7: 0x000a, + 0x36d0: 0x000a, 0x36d1: 0x000a, + 0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a, 0x36d7: 0x000a, + 0x36d8: 0x000a, 0x36d9: 0x000a, + 0x36e0: 0x000a, 0x36e1: 0x000a, 0x36e2: 0x000a, 0x36e3: 0x000a, + 0x36e4: 0x000a, 0x36e5: 0x000a, 0x36e6: 0x000a, 0x36e7: 0x000a, 0x36e8: 0x000a, 0x36e9: 0x000a, + 0x36ea: 0x000a, 0x36eb: 0x000a, 0x36ec: 0x000a, 0x36ed: 0x000a, 0x36ee: 0x000a, 0x36ef: 0x000a, + 0x36f0: 0x000a, 0x36f1: 0x000a, 0x36f2: 0x000a, 0x36f3: 0x000a, 0x36f4: 0x000a, 0x36f5: 0x000a, + 0x36f6: 0x000a, 0x36f7: 0x000a, 0x36f8: 0x000a, 0x36f9: 0x000a, 0x36fa: 0x000a, 0x36fb: 0x000a, + 0x36fc: 0x000a, 0x36fd: 0x000a, 0x36fe: 0x000a, 0x36ff: 0x000a, + // Block 0xdc, offset 0x3700 + 0x3700: 0x000a, 0x3701: 0x000a, 0x3702: 0x000a, 0x3703: 0x000a, 0x3704: 0x000a, 0x3705: 0x000a, + 0x3706: 0x000a, 0x3707: 0x000a, + 0x3710: 0x000a, 0x3711: 0x000a, + 0x3712: 0x000a, 0x3713: 0x000a, 0x3714: 0x000a, 0x3715: 0x000a, 0x3716: 0x000a, 0x3717: 0x000a, + 0x3718: 0x000a, 0x3719: 0x000a, 0x371a: 0x000a, 0x371b: 0x000a, 0x371c: 0x000a, 0x371d: 0x000a, + 0x371e: 0x000a, 0x371f: 0x000a, 0x3720: 0x000a, 0x3721: 0x000a, 0x3722: 0x000a, 0x3723: 0x000a, + 0x3724: 0x000a, 0x3725: 0x000a, 0x3726: 0x000a, 0x3727: 0x000a, 0x3728: 0x000a, 0x3729: 0x000a, + 0x372a: 0x000a, 0x372b: 0x000a, 0x372c: 0x000a, 0x372d: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3740: 0x000a, 0x3741: 0x000a, 0x3742: 0x000a, 0x3743: 0x000a, 0x3744: 0x000a, 0x3745: 0x000a, + 0x3746: 0x000a, 0x3747: 0x000a, 0x3748: 0x000a, 0x3749: 0x000a, 0x374a: 0x000a, 0x374b: 0x000a, + 0x3750: 0x000a, 0x3751: 0x000a, + 0x3752: 0x000a, 0x3753: 0x000a, 0x3754: 0x000a, 0x3755: 0x000a, 0x3756: 0x000a, 0x3757: 0x000a, + 0x3758: 0x000a, 0x3759: 0x000a, 0x375a: 0x000a, 0x375b: 0x000a, 0x375c: 0x000a, 0x375d: 0x000a, + 0x375e: 0x000a, 0x375f: 0x000a, 0x3760: 0x000a, 0x3761: 0x000a, 0x3762: 0x000a, 0x3763: 0x000a, + 0x3764: 0x000a, 0x3765: 0x000a, 0x3766: 0x000a, 0x3767: 0x000a, 0x3768: 0x000a, 0x3769: 0x000a, + 0x376a: 0x000a, 0x376b: 0x000a, 0x376c: 0x000a, 0x376d: 0x000a, 0x376e: 0x000a, 0x376f: 0x000a, + 0x3770: 0x000a, 0x3771: 0x000a, 0x3772: 0x000a, 0x3773: 0x000a, 0x3774: 0x000a, 0x3775: 0x000a, + 0x3776: 0x000a, 0x3777: 0x000a, 0x3778: 0x000a, 0x3779: 0x000a, 0x377a: 0x000a, 0x377b: 0x000a, + 0x377c: 0x000a, 0x377d: 0x000a, 0x377e: 0x000a, + // Block 0xde, offset 0x3780 + 0x3780: 0x000a, 0x3781: 0x000a, 0x3782: 0x000a, 0x3783: 0x000a, 0x3784: 0x000a, 0x3785: 0x000a, + 0x3786: 0x000a, 0x3787: 0x000a, 0x3788: 0x000a, 0x3789: 0x000a, 0x378a: 0x000a, 0x378b: 0x000a, + 0x378c: 0x000a, 0x3790: 0x000a, 0x3791: 0x000a, + 0x3792: 0x000a, 0x3793: 0x000a, 0x3794: 0x000a, 0x3795: 0x000a, 0x3796: 0x000a, 0x3797: 0x000a, + 0x3798: 0x000a, 0x3799: 0x000a, 0x379a: 0x000a, 0x379b: 0x000a, 0x379c: 0x000a, 0x379d: 0x000a, + 0x379e: 0x000a, 0x379f: 0x000a, 0x37a0: 0x000a, 0x37a1: 0x000a, 0x37a2: 0x000a, 0x37a3: 0x000a, + 0x37a4: 0x000a, 0x37a5: 0x000a, 0x37a6: 0x000a, 0x37a7: 0x000a, 0x37a8: 0x000a, 0x37a9: 0x000a, + 0x37aa: 0x000a, 0x37ab: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c0: 0x000a, 0x37c1: 0x000a, 0x37c2: 0x000a, 0x37c3: 0x000a, 0x37c4: 0x000a, 0x37c5: 0x000a, + 0x37c6: 0x000a, 0x37c7: 0x000a, 0x37c8: 0x000a, 0x37c9: 0x000a, 0x37ca: 0x000a, 0x37cb: 0x000a, + 0x37cc: 0x000a, 0x37cd: 0x000a, 0x37ce: 0x000a, 0x37cf: 0x000a, 0x37d0: 0x000a, 0x37d1: 0x000a, + 0x37d2: 0x000a, 0x37d3: 0x000a, 0x37d4: 0x000a, 0x37d5: 0x000a, 0x37d6: 0x000a, 0x37d7: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3800: 0x000a, + 0x3810: 0x000a, 0x3811: 0x000a, + 0x3812: 0x000a, 0x3813: 0x000a, 0x3814: 0x000a, 0x3815: 0x000a, 0x3816: 0x000a, 0x3817: 0x000a, + 0x3818: 0x000a, 0x3819: 0x000a, 0x381a: 0x000a, 0x381b: 0x000a, 0x381c: 0x000a, 0x381d: 0x000a, + 0x381e: 0x000a, 0x381f: 0x000a, 0x3820: 0x000a, 0x3821: 0x000a, 0x3822: 0x000a, 0x3823: 0x000a, + 0x3824: 0x000a, 0x3825: 0x000a, 0x3826: 0x000a, + // Block 0xe1, offset 0x3840 + 0x387e: 0x000b, 0x387f: 0x000b, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000b, 0x3881: 0x000b, 0x3882: 0x000b, 0x3883: 0x000b, 0x3884: 0x000b, 0x3885: 0x000b, + 0x3886: 0x000b, 0x3887: 0x000b, 0x3888: 0x000b, 0x3889: 0x000b, 0x388a: 0x000b, 0x388b: 0x000b, + 0x388c: 0x000b, 0x388d: 0x000b, 0x388e: 0x000b, 0x388f: 0x000b, 0x3890: 0x000b, 0x3891: 0x000b, + 0x3892: 0x000b, 0x3893: 0x000b, 0x3894: 0x000b, 0x3895: 0x000b, 0x3896: 0x000b, 0x3897: 0x000b, + 0x3898: 0x000b, 0x3899: 0x000b, 0x389a: 0x000b, 0x389b: 0x000b, 0x389c: 0x000b, 0x389d: 0x000b, + 0x389e: 0x000b, 0x389f: 0x000b, 0x38a0: 0x000b, 0x38a1: 0x000b, 0x38a2: 0x000b, 0x38a3: 0x000b, + 0x38a4: 0x000b, 0x38a5: 0x000b, 0x38a6: 0x000b, 0x38a7: 0x000b, 0x38a8: 0x000b, 0x38a9: 0x000b, + 0x38aa: 0x000b, 0x38ab: 0x000b, 0x38ac: 0x000b, 0x38ad: 0x000b, 0x38ae: 0x000b, 0x38af: 0x000b, + 0x38b0: 0x000b, 0x38b1: 0x000b, 0x38b2: 0x000b, 0x38b3: 0x000b, 0x38b4: 0x000b, 0x38b5: 0x000b, + 0x38b6: 0x000b, 0x38b7: 0x000b, 0x38b8: 0x000b, 0x38b9: 0x000b, 0x38ba: 0x000b, 0x38bb: 0x000b, + 0x38bc: 0x000b, 0x38bd: 0x000b, 0x38be: 0x000b, 0x38bf: 0x000b, + // Block 0xe3, offset 0x38c0 + 0x38c0: 0x000c, 0x38c1: 0x000c, 0x38c2: 0x000c, 0x38c3: 0x000c, 0x38c4: 0x000c, 0x38c5: 0x000c, + 0x38c6: 0x000c, 0x38c7: 0x000c, 0x38c8: 0x000c, 0x38c9: 0x000c, 0x38ca: 0x000c, 0x38cb: 0x000c, + 0x38cc: 0x000c, 0x38cd: 0x000c, 0x38ce: 0x000c, 0x38cf: 0x000c, 0x38d0: 0x000c, 0x38d1: 0x000c, + 0x38d2: 0x000c, 0x38d3: 0x000c, 0x38d4: 0x000c, 0x38d5: 0x000c, 0x38d6: 0x000c, 0x38d7: 0x000c, + 0x38d8: 0x000c, 0x38d9: 0x000c, 0x38da: 0x000c, 0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c, + 0x38de: 0x000c, 0x38df: 0x000c, 0x38e0: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c, + 0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c, + 0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c, + 0x38f0: 0x000b, 0x38f1: 0x000b, 0x38f2: 0x000b, 0x38f3: 0x000b, 0x38f4: 0x000b, 0x38f5: 0x000b, + 0x38f6: 0x000b, 0x38f7: 0x000b, 0x38f8: 0x000b, 0x38f9: 0x000b, 0x38fa: 0x000b, 0x38fb: 0x000b, + 0x38fc: 0x000b, 0x38fd: 0x000b, 0x38fe: 0x000b, 0x38ff: 0x000b, +} + +// bidiIndex: 24 blocks, 1536 entries, 1536 bytes +// Block 0 is the zero block. +var bidiIndex = [1536]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x11, 0xf1: 0x12, 0xf2: 0x12, 0xf3: 0x14, 0xf4: 0x15, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x137: 0x28, + 0x138: 0x29, 0x139: 0x2a, 0x13a: 0x2b, 0x13b: 0x2c, 0x13c: 0x2d, 0x13d: 0x2e, 0x13e: 0x2f, 0x13f: 0x30, + // Block 0x5, offset 0x140 + 0x140: 0x31, 0x141: 0x32, 0x142: 0x33, + 0x14d: 0x34, 0x14e: 0x35, + 0x150: 0x36, + 0x15a: 0x37, 0x15c: 0x38, 0x15d: 0x39, 0x15e: 0x3a, 0x15f: 0x3b, + 0x160: 0x3c, 0x162: 0x3d, 0x164: 0x3e, 0x165: 0x3f, 0x167: 0x40, + 0x168: 0x41, 0x169: 0x42, 0x16a: 0x43, 0x16c: 0x44, 0x16d: 0x45, 0x16e: 0x46, 0x16f: 0x47, + 0x170: 0x48, 0x173: 0x49, 0x177: 0x4a, + 0x17e: 0x4b, 0x17f: 0x4c, + // Block 0x6, offset 0x180 + 0x180: 0x4d, 0x181: 0x4e, 0x182: 0x4f, 0x183: 0x50, 0x184: 0x51, 0x185: 0x52, 0x186: 0x53, 0x187: 0x54, + 0x188: 0x55, 0x189: 0x54, 0x18a: 0x54, 0x18b: 0x54, 0x18c: 0x56, 0x18d: 0x57, 0x18e: 0x58, 0x18f: 0x54, + 0x190: 0x59, 0x191: 0x5a, 0x192: 0x5b, 0x193: 0x5c, 0x194: 0x54, 0x195: 0x54, 0x196: 0x54, 0x197: 0x54, + 0x198: 0x54, 0x199: 0x54, 0x19a: 0x5d, 0x19b: 0x54, 0x19c: 0x54, 0x19d: 0x5e, 0x19e: 0x54, 0x19f: 0x5f, + 0x1a4: 0x54, 0x1a5: 0x54, 0x1a6: 0x60, 0x1a7: 0x61, + 0x1a8: 0x54, 0x1a9: 0x54, 0x1aa: 0x54, 0x1ab: 0x54, 0x1ac: 0x54, 0x1ad: 0x62, 0x1ae: 0x63, 0x1af: 0x64, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x54, 0x1bd: 0x54, 0x1be: 0x54, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x54, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26f: 0x8a, + // Block 0xa, offset 0x280 + 0x2ac: 0x8b, 0x2ad: 0x8c, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8d, 0x2b5: 0x0e, 0x2b6: 0x0e, 0x2b7: 0x8e, + 0x2b8: 0x8f, 0x2b9: 0x90, 0x2ba: 0x0e, 0x2bb: 0x91, 0x2bc: 0x92, 0x2bd: 0x93, 0x2bf: 0x94, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x95, 0x2c5: 0x54, 0x2c6: 0x96, 0x2c7: 0x97, + 0x2cb: 0x98, 0x2cd: 0x99, + 0x2e0: 0x9a, 0x2e1: 0x9a, 0x2e2: 0x9a, 0x2e3: 0x9a, 0x2e4: 0x9b, 0x2e5: 0x9a, 0x2e6: 0x9a, 0x2e7: 0x9a, + 0x2e8: 0x9c, 0x2e9: 0x9a, 0x2ea: 0x9a, 0x2eb: 0x9d, 0x2ec: 0x9e, 0x2ed: 0x9a, 0x2ee: 0x9a, 0x2ef: 0x9a, + 0x2f0: 0x9a, 0x2f1: 0x9a, 0x2f2: 0x9a, 0x2f3: 0x9a, 0x2f4: 0x9a, 0x2f5: 0x9a, 0x2f6: 0x9a, 0x2f7: 0x9a, + 0x2f8: 0x9a, 0x2f9: 0x9f, 0x2fa: 0x9a, 0x2fb: 0x9a, 0x2fc: 0x9a, 0x2fd: 0x9a, 0x2fe: 0x9a, 0x2ff: 0x9a, + // Block 0xc, offset 0x300 + 0x300: 0xa0, 0x301: 0xa1, 0x302: 0xa2, 0x304: 0xa3, 0x305: 0xa4, 0x306: 0xa5, 0x307: 0xa6, + 0x308: 0xa7, 0x30b: 0xa8, 0x30c: 0xa9, 0x30d: 0xaa, + 0x310: 0xab, 0x311: 0xac, 0x312: 0xad, 0x313: 0xae, 0x316: 0xaf, 0x317: 0xb0, + 0x318: 0xb1, 0x319: 0xb2, 0x31a: 0xb3, 0x31c: 0xb4, + 0x328: 0xb5, 0x329: 0xb6, 0x32a: 0xb7, + 0x330: 0xb8, 0x332: 0xb9, 0x334: 0xba, 0x335: 0xbb, + // Block 0xd, offset 0x340 + 0x36b: 0xbc, 0x36c: 0xbd, + 0x37e: 0xbe, + // Block 0xe, offset 0x380 + 0x3b2: 0xbf, + // Block 0xf, offset 0x3c0 + 0x3c5: 0xc0, 0x3c6: 0xc1, + 0x3c8: 0x54, 0x3c9: 0xc2, 0x3cc: 0x54, 0x3cd: 0xc3, + 0x3db: 0xc4, 0x3dc: 0xc5, 0x3dd: 0xc6, 0x3de: 0xc7, 0x3df: 0xc8, + 0x3e8: 0xc9, 0x3e9: 0xca, 0x3ea: 0xcb, + // Block 0x10, offset 0x400 + 0x400: 0xcc, + 0x420: 0x9a, 0x421: 0x9a, 0x422: 0x9a, 0x423: 0xcd, 0x424: 0x9a, 0x425: 0xce, 0x426: 0x9a, 0x427: 0x9a, + 0x428: 0x9a, 0x429: 0x9a, 0x42a: 0x9a, 0x42b: 0x9a, 0x42c: 0x9a, 0x42d: 0x9a, 0x42e: 0x9a, 0x42f: 0x9a, + 0x430: 0x9a, 0x431: 0x9a, 0x432: 0x9a, 0x433: 0x9a, 0x434: 0x9a, 0x435: 0x9a, 0x436: 0x9a, 0x437: 0x9a, + 0x438: 0x0e, 0x439: 0x0e, 0x43a: 0x0e, 0x43b: 0xcf, 0x43c: 0x9a, 0x43d: 0x9a, 0x43e: 0x9a, 0x43f: 0x9a, + // Block 0x11, offset 0x440 + 0x440: 0xd0, 0x441: 0x54, 0x442: 0xd1, 0x443: 0xd2, 0x444: 0xd3, 0x445: 0xd4, + 0x449: 0xd5, 0x44c: 0x54, 0x44d: 0x54, 0x44e: 0x54, 0x44f: 0x54, + 0x450: 0x54, 0x451: 0x54, 0x452: 0x54, 0x453: 0x54, 0x454: 0x54, 0x455: 0x54, 0x456: 0x54, 0x457: 0x54, + 0x458: 0x54, 0x459: 0x54, 0x45a: 0x54, 0x45b: 0xd6, 0x45c: 0x54, 0x45d: 0x6b, 0x45e: 0x54, 0x45f: 0xd7, + 0x460: 0xd8, 0x461: 0xd9, 0x462: 0xda, 0x464: 0xdb, 0x465: 0xdc, 0x466: 0xdd, 0x467: 0xde, + 0x47f: 0xdf, + // Block 0x12, offset 0x480 + 0x4bf: 0xdf, + // Block 0x13, offset 0x4c0 + 0x4d0: 0x09, 0x4d1: 0x0a, 0x4d6: 0x0b, + 0x4db: 0x0c, 0x4dd: 0x0d, 0x4de: 0x0e, 0x4df: 0x0f, + 0x4ef: 0x10, + 0x4ff: 0x10, + // Block 0x14, offset 0x500 + 0x50f: 0x10, + 0x51f: 0x10, + 0x52f: 0x10, + 0x53f: 0x10, + // Block 0x15, offset 0x540 + 0x540: 0xe0, 0x541: 0xe0, 0x542: 0xe0, 0x543: 0xe0, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0xe1, + 0x548: 0xe0, 0x549: 0xe0, 0x54a: 0xe0, 0x54b: 0xe0, 0x54c: 0xe0, 0x54d: 0xe0, 0x54e: 0xe0, 0x54f: 0xe0, + 0x550: 0xe0, 0x551: 0xe0, 0x552: 0xe0, 0x553: 0xe0, 0x554: 0xe0, 0x555: 0xe0, 0x556: 0xe0, 0x557: 0xe0, + 0x558: 0xe0, 0x559: 0xe0, 0x55a: 0xe0, 0x55b: 0xe0, 0x55c: 0xe0, 0x55d: 0xe0, 0x55e: 0xe0, 0x55f: 0xe0, + 0x560: 0xe0, 0x561: 0xe0, 0x562: 0xe0, 0x563: 0xe0, 0x564: 0xe0, 0x565: 0xe0, 0x566: 0xe0, 0x567: 0xe0, + 0x568: 0xe0, 0x569: 0xe0, 0x56a: 0xe0, 0x56b: 0xe0, 0x56c: 0xe0, 0x56d: 0xe0, 0x56e: 0xe0, 0x56f: 0xe0, + 0x570: 0xe0, 0x571: 0xe0, 0x572: 0xe0, 0x573: 0xe0, 0x574: 0xe0, 0x575: 0xe0, 0x576: 0xe0, 0x577: 0xe0, + 0x578: 0xe0, 0x579: 0xe0, 0x57a: 0xe0, 0x57b: 0xe0, 0x57c: 0xe0, 0x57d: 0xe0, 0x57e: 0xe0, 0x57f: 0xe0, + // Block 0x16, offset 0x580 + 0x58f: 0x10, + 0x59f: 0x10, + 0x5a0: 0x13, + 0x5af: 0x10, + 0x5bf: 0x10, + // Block 0x17, offset 0x5c0 + 0x5cf: 0x10, +} + +// Total table size 16184 bytes (15KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/bidi/tables.go b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go similarity index 99% rename from vendor/golang.org/x/text/unicode/bidi/tables.go rename to vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go index 7212d5add1..0ca0193ebe 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go @@ -1,5 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. +// +build !go1.10 + package bidi // UnicodeVersion is the Unicode version from which the tables in this package are derived. diff --git a/vendor/golang.org/x/text/unicode/norm/BUILD b/vendor/golang.org/x/text/unicode/norm/BUILD index 65d73d82a6..40e071558d 100644 --- a/vendor/golang.org/x/text/unicode/norm/BUILD +++ b/vendor/golang.org/x/text/unicode/norm/BUILD @@ -9,7 +9,8 @@ go_library( "iter.go", "normalize.go", "readwriter.go", - "tables.go", + "tables10.0.0.go", + "tables9.0.0.go", "transform.go", "trie.go", ], diff --git a/vendor/golang.org/x/text/unicode/norm/composition.go b/vendor/golang.org/x/text/unicode/norm/composition.go index bab4c5de02..e2087bce52 100644 --- a/vendor/golang.org/x/text/unicode/norm/composition.go +++ b/vendor/golang.org/x/text/unicode/norm/composition.go @@ -407,7 +407,7 @@ func decomposeHangul(buf []byte, r rune) int { // decomposeHangul algorithmically decomposes a Hangul rune into // its Jamo components. -// See http://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul. +// See https://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul. func (rb *reorderBuffer) decomposeHangul(r rune) { r -= hangulBase x := r % jamoTCount @@ -420,7 +420,7 @@ func (rb *reorderBuffer) decomposeHangul(r rune) { } // combineHangul algorithmically combines Jamo character components into Hangul. -// See http://unicode.org/reports/tr15/#Hangul for details on combining Hangul. +// See https://unicode.org/reports/tr15/#Hangul for details on combining Hangul. func (rb *reorderBuffer) combineHangul(s, i, k int) { b := rb.rune[:] bn := rb.nrune @@ -461,6 +461,10 @@ func (rb *reorderBuffer) combineHangul(s, i, k int) { // It should only be used to recompose a single segment, as it will not // handle alternations between Hangul and non-Hangul characters correctly. func (rb *reorderBuffer) compose() { + // Lazily load the map used by the combine func below, but do + // it outside of the loop. + recompMapOnce.Do(buildRecompMap) + // UAX #15, section X5 , including Corrigendum #5 // "In any character sequence beginning with starter S, a character C is // blocked from S if and only if there is some character B between S diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index e67e7655c5..526c7033ac 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -4,6 +4,8 @@ package norm +import "encoding/binary" + // This file contains Form-specific logic and wrappers for data in tables.go. // Rune info is stored in a separate trie per composing form. A composing form @@ -178,6 +180,17 @@ func (p Properties) TrailCCC() uint8 { return ccc[p.tccc] } +func buildRecompMap() { + recompMap = make(map[uint32]rune, len(recompMapPacked)/8) + var buf [8]byte + for i := 0; i < len(recompMapPacked); i += 8 { + copy(buf[:], recompMapPacked[i:i+8]) + key := binary.BigEndian.Uint32(buf[:4]) + val := binary.BigEndian.Uint32(buf[4:]) + recompMap[key] = rune(val) + } +} + // Recomposition // We use 32-bit keys instead of 64-bit for the two codepoint keys. // This clips off the bits of three entries, but we know this will not @@ -186,8 +199,14 @@ func (p Properties) TrailCCC() uint8 { // Note that the recomposition map for NFC and NFKC are identical. // combine returns the combined rune or 0 if it doesn't exist. +// +// The caller is responsible for calling +// recompMapOnce.Do(buildRecompMap) sometime before this is called. func combine(a, b rune) rune { key := uint32(uint16(a))<<16 + uint32(uint16(b)) + if recompMap == nil { + panic("caller error") // see func comment + } return recompMap[key] } diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go index ce17f96c2e..417c6b2689 100644 --- a/vendor/golang.org/x/text/unicode/norm/iter.go +++ b/vendor/golang.org/x/text/unicode/norm/iter.go @@ -128,8 +128,9 @@ func (i *Iter) Next() []byte { func nextASCIIBytes(i *Iter) []byte { p := i.p + 1 if p >= i.rb.nsrc { + p0 := i.p i.setDone() - return i.rb.src.bytes[i.p:p] + return i.rb.src.bytes[p0:p] } if i.rb.src.bytes[p] < utf8.RuneSelf { p0 := i.p diff --git a/vendor/golang.org/x/text/unicode/norm/maketables.go b/vendor/golang.org/x/text/unicode/norm/maketables.go index 8d418160ca..30a3aa9334 100644 --- a/vendor/golang.org/x/text/unicode/norm/maketables.go +++ b/vendor/golang.org/x/text/unicode/norm/maketables.go @@ -12,6 +12,7 @@ package main import ( "bytes" + "encoding/binary" "flag" "fmt" "io" @@ -261,7 +262,7 @@ func compactCCC() { // CompositionExclusions.txt has form: // 0958 # ... -// See http://unicode.org/reports/tr44/ for full explanation +// See https://unicode.org/reports/tr44/ for full explanation func loadCompositionExclusions() { f := gen.OpenUCDFile("CompositionExclusions.txt") defer f.Close() @@ -735,6 +736,8 @@ func makeTables() { max = n } } + fmt.Fprintln(w, `import "sync"`) + fmt.Fprintln(w) fmt.Fprintln(w, "const (") fmt.Fprintln(w, "\t// Version is the Unicode edition from which the tables are derived.") @@ -782,20 +785,27 @@ func makeTables() { sz := nrentries * 8 size += sz fmt.Fprintf(w, "// recompMap: %d bytes (entries only)\n", sz) - fmt.Fprintln(w, "var recompMap = map[uint32]rune{") + fmt.Fprintln(w, "var recompMap map[uint32]rune") + fmt.Fprintln(w, "var recompMapOnce sync.Once\n") + fmt.Fprintln(w, `const recompMapPacked = "" +`) + var buf [8]byte for i, c := range chars { f := c.forms[FCanonical] d := f.decomp if !f.isOneWay && len(d) > 0 { key := uint32(uint16(d[0]))<<16 + uint32(uint16(d[1])) - fmt.Fprintf(w, "0x%.8X: 0x%.4X,\n", key, i) + binary.BigEndian.PutUint32(buf[:4], key) + binary.BigEndian.PutUint32(buf[4:], uint32(i)) + fmt.Fprintf(w, "\t\t%q + // 0x%.8X: 0x%.8X\n", string(buf[:]), key, uint32(i)) } } - fmt.Fprintf(w, "}\n\n") + // hack so we don't have to special case the trailing plus sign + fmt.Fprintf(w, ` ""`) + fmt.Fprintln(w) } fmt.Fprintf(w, "// Total size of tables: %dKB (%d bytes)\n", (size+512)/1024, size) - gen.WriteGoFile("tables.go", "norm", w.Bytes()) + gen.WriteVersionedGoFile("tables.go", "norm", w.Bytes()) } func printChars() { @@ -857,7 +867,7 @@ func verifyComputed() { // DerivedNormalizationProps.txt has form: // 00C0..00C5 ; NFD_QC; N # ... // 0374 ; NFD_QC; N # ... -// See http://unicode.org/reports/tr44/ for full explanation +// See https://unicode.org/reports/tr44/ for full explanation func testDerived() { f := gen.OpenUCDFile("DerivedNormalizationProps.txt") defer f.Close() @@ -972,5 +982,5 @@ func printTestdata() { } } fmt.Fprintln(w, "}") - gen.WriteGoFile("data_test.go", "norm", w.Bytes()) + gen.WriteVersionedGoFile("data_test.go", "norm", w.Bytes()) } diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index e28ac641ac..95efcf26e8 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -29,8 +29,8 @@ import ( // proceed independently on both sides: // f(x) == append(f(x[0:n]), f(x[n:])...) // -// References: http://unicode.org/reports/tr15/ and -// http://unicode.org/notes/tn5/. +// References: https://unicode.org/reports/tr15/ and +// https://unicode.org/notes/tn5/. type Form int const ( diff --git a/vendor/golang.org/x/text/unicode/norm/readwriter.go b/vendor/golang.org/x/text/unicode/norm/readwriter.go index d926ee903e..b38096f5ca 100644 --- a/vendor/golang.org/x/text/unicode/norm/readwriter.go +++ b/vendor/golang.org/x/text/unicode/norm/readwriter.go @@ -60,8 +60,8 @@ func (w *normWriter) Close() error { } // Writer returns a new writer that implements Write(b) -// by writing f(b) to w. The returned writer may use an -// an internal buffer to maintain state across Write calls. +// by writing f(b) to w. The returned writer may use an +// internal buffer to maintain state across Write calls. // Calling its Close method writes any buffered data to w. func (f Form) Writer(w io.Writer) io.WriteCloser { wr := &normWriter{rb: reorderBuffer{}, w: w} diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go new file mode 100644 index 0000000000..c48a97b0c2 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go @@ -0,0 +1,7657 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// +build go1.10 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "10.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [55]uint8{ + 0, 1, 7, 8, 9, 10, 11, 12, + 13, 14, 15, 16, 17, 18, 19, 20, + 21, 22, 23, 24, 25, 26, 27, 28, + 29, 30, 31, 32, 33, 34, 35, 36, + 84, 91, 103, 107, 118, 122, 129, 130, + 132, 202, 214, 216, 218, 220, 222, 224, + 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x186D + firstCCC = 0x2C9E + endMulti = 0x2F60 + firstLeadingCCC = 0x49AE + firstCCCZeroExcept = 0x4A78 + firstStarterWithNLead = 0x4A9F + lastDecomp = 0x4AA1 + maxDecomp = 0x8000 +) + +// decomps: 19105 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xB0, 0x42, + 0xC4, 0xA6, 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, + 0x42, 0xC5, 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, + 0x8E, 0x42, 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, + 0xC8, 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, + 0x42, 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, + // Bytes 100 - 13f + 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, 0x99, 0x42, + 0xC9, 0x9B, 0x42, 0xC9, 0x9C, 0x42, 0xC9, 0x9F, + 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA3, 0x42, 0xC9, + 0xA5, 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA8, 0x42, + 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, 0xC9, 0xAB, + 0x42, 0xC9, 0xAD, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, + 0xBB, 0x42, 0xCA, 0x81, 0x42, 0xCA, 0x82, 0x42, + 0xCA, 0x83, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, 0x42, + 0xCA, 0x95, 0x42, 0xCA, 0x9D, 0x42, 0xCA, 0x9F, + 0x42, 0xCA, 0xB9, 0x42, 0xCE, 0x91, 0x42, 0xCE, + 0x92, 0x42, 0xCE, 0x93, 0x42, 0xCE, 0x94, 0x42, + // Bytes 180 - 1bf + 0xCE, 0x95, 0x42, 0xCE, 0x96, 0x42, 0xCE, 0x97, + 0x42, 0xCE, 0x98, 0x42, 0xCE, 0x99, 0x42, 0xCE, + 0x9A, 0x42, 0xCE, 0x9B, 0x42, 0xCE, 0x9C, 0x42, + 0xCE, 0x9D, 0x42, 0xCE, 0x9E, 0x42, 0xCE, 0x9F, + 0x42, 0xCE, 0xA0, 0x42, 0xCE, 0xA1, 0x42, 0xCE, + 0xA3, 0x42, 0xCE, 0xA4, 0x42, 0xCE, 0xA5, 0x42, + 0xCE, 0xA6, 0x42, 0xCE, 0xA7, 0x42, 0xCE, 0xA8, + 0x42, 0xCE, 0xA9, 0x42, 0xCE, 0xB1, 0x42, 0xCE, + // Bytes 1c0 - 1ff + 0xB2, 0x42, 0xCE, 0xB3, 0x42, 0xCE, 0xB4, 0x42, + 0xCE, 0xB5, 0x42, 0xCE, 0xB6, 0x42, 0xCE, 0xB7, + 0x42, 0xCE, 0xB8, 0x42, 0xCE, 0xB9, 0x42, 0xCE, + 0xBA, 0x42, 0xCE, 0xBB, 0x42, 0xCE, 0xBC, 0x42, + 0xCE, 0xBD, 0x42, 0xCE, 0xBE, 0x42, 0xCE, 0xBF, + 0x42, 0xCF, 0x80, 0x42, 0xCF, 0x81, 0x42, 0xCF, + 0x82, 0x42, 0xCF, 0x83, 0x42, 0xCF, 0x84, 0x42, + 0xCF, 0x85, 0x42, 0xCF, 0x86, 0x42, 0xCF, 0x87, + // Bytes 200 - 23f + 0x42, 0xCF, 0x88, 0x42, 0xCF, 0x89, 0x42, 0xCF, + 0x9C, 0x42, 0xCF, 0x9D, 0x42, 0xD0, 0xBD, 0x42, + 0xD1, 0x8A, 0x42, 0xD1, 0x8C, 0x42, 0xD7, 0x90, + 0x42, 0xD7, 0x91, 0x42, 0xD7, 0x92, 0x42, 0xD7, + 0x93, 0x42, 0xD7, 0x94, 0x42, 0xD7, 0x9B, 0x42, + 0xD7, 0x9C, 0x42, 0xD7, 0x9D, 0x42, 0xD7, 0xA2, + 0x42, 0xD7, 0xA8, 0x42, 0xD7, 0xAA, 0x42, 0xD8, + 0xA1, 0x42, 0xD8, 0xA7, 0x42, 0xD8, 0xA8, 0x42, + // Bytes 240 - 27f + 0xD8, 0xA9, 0x42, 0xD8, 0xAA, 0x42, 0xD8, 0xAB, + 0x42, 0xD8, 0xAC, 0x42, 0xD8, 0xAD, 0x42, 0xD8, + 0xAE, 0x42, 0xD8, 0xAF, 0x42, 0xD8, 0xB0, 0x42, + 0xD8, 0xB1, 0x42, 0xD8, 0xB2, 0x42, 0xD8, 0xB3, + 0x42, 0xD8, 0xB4, 0x42, 0xD8, 0xB5, 0x42, 0xD8, + 0xB6, 0x42, 0xD8, 0xB7, 0x42, 0xD8, 0xB8, 0x42, + 0xD8, 0xB9, 0x42, 0xD8, 0xBA, 0x42, 0xD9, 0x81, + 0x42, 0xD9, 0x82, 0x42, 0xD9, 0x83, 0x42, 0xD9, + // Bytes 280 - 2bf + 0x84, 0x42, 0xD9, 0x85, 0x42, 0xD9, 0x86, 0x42, + 0xD9, 0x87, 0x42, 0xD9, 0x88, 0x42, 0xD9, 0x89, + 0x42, 0xD9, 0x8A, 0x42, 0xD9, 0xAE, 0x42, 0xD9, + 0xAF, 0x42, 0xD9, 0xB1, 0x42, 0xD9, 0xB9, 0x42, + 0xD9, 0xBA, 0x42, 0xD9, 0xBB, 0x42, 0xD9, 0xBE, + 0x42, 0xD9, 0xBF, 0x42, 0xDA, 0x80, 0x42, 0xDA, + 0x83, 0x42, 0xDA, 0x84, 0x42, 0xDA, 0x86, 0x42, + 0xDA, 0x87, 0x42, 0xDA, 0x88, 0x42, 0xDA, 0x8C, + // Bytes 2c0 - 2ff + 0x42, 0xDA, 0x8D, 0x42, 0xDA, 0x8E, 0x42, 0xDA, + 0x91, 0x42, 0xDA, 0x98, 0x42, 0xDA, 0xA1, 0x42, + 0xDA, 0xA4, 0x42, 0xDA, 0xA6, 0x42, 0xDA, 0xA9, + 0x42, 0xDA, 0xAD, 0x42, 0xDA, 0xAF, 0x42, 0xDA, + 0xB1, 0x42, 0xDA, 0xB3, 0x42, 0xDA, 0xBA, 0x42, + 0xDA, 0xBB, 0x42, 0xDA, 0xBE, 0x42, 0xDB, 0x81, + 0x42, 0xDB, 0x85, 0x42, 0xDB, 0x86, 0x42, 0xDB, + 0x87, 0x42, 0xDB, 0x88, 0x42, 0xDB, 0x89, 0x42, + // Bytes 300 - 33f + 0xDB, 0x8B, 0x42, 0xDB, 0x8C, 0x42, 0xDB, 0x90, + 0x42, 0xDB, 0x92, 0x43, 0xE0, 0xBC, 0x8B, 0x43, + 0xE1, 0x83, 0x9C, 0x43, 0xE1, 0x84, 0x80, 0x43, + 0xE1, 0x84, 0x81, 0x43, 0xE1, 0x84, 0x82, 0x43, + 0xE1, 0x84, 0x83, 0x43, 0xE1, 0x84, 0x84, 0x43, + 0xE1, 0x84, 0x85, 0x43, 0xE1, 0x84, 0x86, 0x43, + 0xE1, 0x84, 0x87, 0x43, 0xE1, 0x84, 0x88, 0x43, + 0xE1, 0x84, 0x89, 0x43, 0xE1, 0x84, 0x8A, 0x43, + // Bytes 340 - 37f + 0xE1, 0x84, 0x8B, 0x43, 0xE1, 0x84, 0x8C, 0x43, + 0xE1, 0x84, 0x8D, 0x43, 0xE1, 0x84, 0x8E, 0x43, + 0xE1, 0x84, 0x8F, 0x43, 0xE1, 0x84, 0x90, 0x43, + 0xE1, 0x84, 0x91, 0x43, 0xE1, 0x84, 0x92, 0x43, + 0xE1, 0x84, 0x94, 0x43, 0xE1, 0x84, 0x95, 0x43, + 0xE1, 0x84, 0x9A, 0x43, 0xE1, 0x84, 0x9C, 0x43, + 0xE1, 0x84, 0x9D, 0x43, 0xE1, 0x84, 0x9E, 0x43, + 0xE1, 0x84, 0xA0, 0x43, 0xE1, 0x84, 0xA1, 0x43, + // Bytes 380 - 3bf + 0xE1, 0x84, 0xA2, 0x43, 0xE1, 0x84, 0xA3, 0x43, + 0xE1, 0x84, 0xA7, 0x43, 0xE1, 0x84, 0xA9, 0x43, + 0xE1, 0x84, 0xAB, 0x43, 0xE1, 0x84, 0xAC, 0x43, + 0xE1, 0x84, 0xAD, 0x43, 0xE1, 0x84, 0xAE, 0x43, + 0xE1, 0x84, 0xAF, 0x43, 0xE1, 0x84, 0xB2, 0x43, + 0xE1, 0x84, 0xB6, 0x43, 0xE1, 0x85, 0x80, 0x43, + 0xE1, 0x85, 0x87, 0x43, 0xE1, 0x85, 0x8C, 0x43, + 0xE1, 0x85, 0x97, 0x43, 0xE1, 0x85, 0x98, 0x43, + // Bytes 3c0 - 3ff + 0xE1, 0x85, 0x99, 0x43, 0xE1, 0x85, 0xA0, 0x43, + 0xE1, 0x86, 0x84, 0x43, 0xE1, 0x86, 0x85, 0x43, + 0xE1, 0x86, 0x88, 0x43, 0xE1, 0x86, 0x91, 0x43, + 0xE1, 0x86, 0x92, 0x43, 0xE1, 0x86, 0x94, 0x43, + 0xE1, 0x86, 0x9E, 0x43, 0xE1, 0x86, 0xA1, 0x43, + 0xE1, 0x87, 0x87, 0x43, 0xE1, 0x87, 0x88, 0x43, + 0xE1, 0x87, 0x8C, 0x43, 0xE1, 0x87, 0x8E, 0x43, + 0xE1, 0x87, 0x93, 0x43, 0xE1, 0x87, 0x97, 0x43, + // Bytes 400 - 43f + 0xE1, 0x87, 0x99, 0x43, 0xE1, 0x87, 0x9D, 0x43, + 0xE1, 0x87, 0x9F, 0x43, 0xE1, 0x87, 0xB1, 0x43, + 0xE1, 0x87, 0xB2, 0x43, 0xE1, 0xB4, 0x82, 0x43, + 0xE1, 0xB4, 0x96, 0x43, 0xE1, 0xB4, 0x97, 0x43, + 0xE1, 0xB4, 0x9C, 0x43, 0xE1, 0xB4, 0x9D, 0x43, + 0xE1, 0xB4, 0xA5, 0x43, 0xE1, 0xB5, 0xBB, 0x43, + 0xE1, 0xB6, 0x85, 0x43, 0xE2, 0x80, 0x82, 0x43, + 0xE2, 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, + // Bytes 440 - 47f + 0xE2, 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, + 0xE2, 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, + 0xE2, 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, + 0xE2, 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, + 0xE2, 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, + 0xE2, 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, + 0xE2, 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, + 0xE2, 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, + // Bytes 480 - 4bf + 0xE2, 0xB5, 0xA1, 0x43, 0xE3, 0x80, 0x81, 0x43, + 0xE3, 0x80, 0x82, 0x43, 0xE3, 0x80, 0x88, 0x43, + 0xE3, 0x80, 0x89, 0x43, 0xE3, 0x80, 0x8A, 0x43, + 0xE3, 0x80, 0x8B, 0x43, 0xE3, 0x80, 0x8C, 0x43, + 0xE3, 0x80, 0x8D, 0x43, 0xE3, 0x80, 0x8E, 0x43, + 0xE3, 0x80, 0x8F, 0x43, 0xE3, 0x80, 0x90, 0x43, + 0xE3, 0x80, 0x91, 0x43, 0xE3, 0x80, 0x92, 0x43, + 0xE3, 0x80, 0x94, 0x43, 0xE3, 0x80, 0x95, 0x43, + // Bytes 4c0 - 4ff + 0xE3, 0x80, 0x96, 0x43, 0xE3, 0x80, 0x97, 0x43, + 0xE3, 0x82, 0xA1, 0x43, 0xE3, 0x82, 0xA2, 0x43, + 0xE3, 0x82, 0xA3, 0x43, 0xE3, 0x82, 0xA4, 0x43, + 0xE3, 0x82, 0xA5, 0x43, 0xE3, 0x82, 0xA6, 0x43, + 0xE3, 0x82, 0xA7, 0x43, 0xE3, 0x82, 0xA8, 0x43, + 0xE3, 0x82, 0xA9, 0x43, 0xE3, 0x82, 0xAA, 0x43, + 0xE3, 0x82, 0xAB, 0x43, 0xE3, 0x82, 0xAD, 0x43, + 0xE3, 0x82, 0xAF, 0x43, 0xE3, 0x82, 0xB1, 0x43, + // Bytes 500 - 53f + 0xE3, 0x82, 0xB3, 0x43, 0xE3, 0x82, 0xB5, 0x43, + 0xE3, 0x82, 0xB7, 0x43, 0xE3, 0x82, 0xB9, 0x43, + 0xE3, 0x82, 0xBB, 0x43, 0xE3, 0x82, 0xBD, 0x43, + 0xE3, 0x82, 0xBF, 0x43, 0xE3, 0x83, 0x81, 0x43, + 0xE3, 0x83, 0x83, 0x43, 0xE3, 0x83, 0x84, 0x43, + 0xE3, 0x83, 0x86, 0x43, 0xE3, 0x83, 0x88, 0x43, + 0xE3, 0x83, 0x8A, 0x43, 0xE3, 0x83, 0x8B, 0x43, + 0xE3, 0x83, 0x8C, 0x43, 0xE3, 0x83, 0x8D, 0x43, + // Bytes 540 - 57f + 0xE3, 0x83, 0x8E, 0x43, 0xE3, 0x83, 0x8F, 0x43, + 0xE3, 0x83, 0x92, 0x43, 0xE3, 0x83, 0x95, 0x43, + 0xE3, 0x83, 0x98, 0x43, 0xE3, 0x83, 0x9B, 0x43, + 0xE3, 0x83, 0x9E, 0x43, 0xE3, 0x83, 0x9F, 0x43, + 0xE3, 0x83, 0xA0, 0x43, 0xE3, 0x83, 0xA1, 0x43, + 0xE3, 0x83, 0xA2, 0x43, 0xE3, 0x83, 0xA3, 0x43, + 0xE3, 0x83, 0xA4, 0x43, 0xE3, 0x83, 0xA5, 0x43, + 0xE3, 0x83, 0xA6, 0x43, 0xE3, 0x83, 0xA7, 0x43, + // Bytes 580 - 5bf + 0xE3, 0x83, 0xA8, 0x43, 0xE3, 0x83, 0xA9, 0x43, + 0xE3, 0x83, 0xAA, 0x43, 0xE3, 0x83, 0xAB, 0x43, + 0xE3, 0x83, 0xAC, 0x43, 0xE3, 0x83, 0xAD, 0x43, + 0xE3, 0x83, 0xAF, 0x43, 0xE3, 0x83, 0xB0, 0x43, + 0xE3, 0x83, 0xB1, 0x43, 0xE3, 0x83, 0xB2, 0x43, + 0xE3, 0x83, 0xB3, 0x43, 0xE3, 0x83, 0xBB, 0x43, + 0xE3, 0x83, 0xBC, 0x43, 0xE3, 0x92, 0x9E, 0x43, + 0xE3, 0x92, 0xB9, 0x43, 0xE3, 0x92, 0xBB, 0x43, + // Bytes 5c0 - 5ff + 0xE3, 0x93, 0x9F, 0x43, 0xE3, 0x94, 0x95, 0x43, + 0xE3, 0x9B, 0xAE, 0x43, 0xE3, 0x9B, 0xBC, 0x43, + 0xE3, 0x9E, 0x81, 0x43, 0xE3, 0xA0, 0xAF, 0x43, + 0xE3, 0xA1, 0xA2, 0x43, 0xE3, 0xA1, 0xBC, 0x43, + 0xE3, 0xA3, 0x87, 0x43, 0xE3, 0xA3, 0xA3, 0x43, + 0xE3, 0xA4, 0x9C, 0x43, 0xE3, 0xA4, 0xBA, 0x43, + 0xE3, 0xA8, 0xAE, 0x43, 0xE3, 0xA9, 0xAC, 0x43, + 0xE3, 0xAB, 0xA4, 0x43, 0xE3, 0xAC, 0x88, 0x43, + // Bytes 600 - 63f + 0xE3, 0xAC, 0x99, 0x43, 0xE3, 0xAD, 0x89, 0x43, + 0xE3, 0xAE, 0x9D, 0x43, 0xE3, 0xB0, 0x98, 0x43, + 0xE3, 0xB1, 0x8E, 0x43, 0xE3, 0xB4, 0xB3, 0x43, + 0xE3, 0xB6, 0x96, 0x43, 0xE3, 0xBA, 0xAC, 0x43, + 0xE3, 0xBA, 0xB8, 0x43, 0xE3, 0xBC, 0x9B, 0x43, + 0xE3, 0xBF, 0xBC, 0x43, 0xE4, 0x80, 0x88, 0x43, + 0xE4, 0x80, 0x98, 0x43, 0xE4, 0x80, 0xB9, 0x43, + 0xE4, 0x81, 0x86, 0x43, 0xE4, 0x82, 0x96, 0x43, + // Bytes 640 - 67f + 0xE4, 0x83, 0xA3, 0x43, 0xE4, 0x84, 0xAF, 0x43, + 0xE4, 0x88, 0x82, 0x43, 0xE4, 0x88, 0xA7, 0x43, + 0xE4, 0x8A, 0xA0, 0x43, 0xE4, 0x8C, 0x81, 0x43, + 0xE4, 0x8C, 0xB4, 0x43, 0xE4, 0x8D, 0x99, 0x43, + 0xE4, 0x8F, 0x95, 0x43, 0xE4, 0x8F, 0x99, 0x43, + 0xE4, 0x90, 0x8B, 0x43, 0xE4, 0x91, 0xAB, 0x43, + 0xE4, 0x94, 0xAB, 0x43, 0xE4, 0x95, 0x9D, 0x43, + 0xE4, 0x95, 0xA1, 0x43, 0xE4, 0x95, 0xAB, 0x43, + // Bytes 680 - 6bf + 0xE4, 0x97, 0x97, 0x43, 0xE4, 0x97, 0xB9, 0x43, + 0xE4, 0x98, 0xB5, 0x43, 0xE4, 0x9A, 0xBE, 0x43, + 0xE4, 0x9B, 0x87, 0x43, 0xE4, 0xA6, 0x95, 0x43, + 0xE4, 0xA7, 0xA6, 0x43, 0xE4, 0xA9, 0xAE, 0x43, + 0xE4, 0xA9, 0xB6, 0x43, 0xE4, 0xAA, 0xB2, 0x43, + 0xE4, 0xAC, 0xB3, 0x43, 0xE4, 0xAF, 0x8E, 0x43, + 0xE4, 0xB3, 0x8E, 0x43, 0xE4, 0xB3, 0xAD, 0x43, + 0xE4, 0xB3, 0xB8, 0x43, 0xE4, 0xB5, 0x96, 0x43, + // Bytes 6c0 - 6ff + 0xE4, 0xB8, 0x80, 0x43, 0xE4, 0xB8, 0x81, 0x43, + 0xE4, 0xB8, 0x83, 0x43, 0xE4, 0xB8, 0x89, 0x43, + 0xE4, 0xB8, 0x8A, 0x43, 0xE4, 0xB8, 0x8B, 0x43, + 0xE4, 0xB8, 0x8D, 0x43, 0xE4, 0xB8, 0x99, 0x43, + 0xE4, 0xB8, 0xA6, 0x43, 0xE4, 0xB8, 0xA8, 0x43, + 0xE4, 0xB8, 0xAD, 0x43, 0xE4, 0xB8, 0xB2, 0x43, + 0xE4, 0xB8, 0xB6, 0x43, 0xE4, 0xB8, 0xB8, 0x43, + 0xE4, 0xB8, 0xB9, 0x43, 0xE4, 0xB8, 0xBD, 0x43, + // Bytes 700 - 73f + 0xE4, 0xB8, 0xBF, 0x43, 0xE4, 0xB9, 0x81, 0x43, + 0xE4, 0xB9, 0x99, 0x43, 0xE4, 0xB9, 0x9D, 0x43, + 0xE4, 0xBA, 0x82, 0x43, 0xE4, 0xBA, 0x85, 0x43, + 0xE4, 0xBA, 0x86, 0x43, 0xE4, 0xBA, 0x8C, 0x43, + 0xE4, 0xBA, 0x94, 0x43, 0xE4, 0xBA, 0xA0, 0x43, + 0xE4, 0xBA, 0xA4, 0x43, 0xE4, 0xBA, 0xAE, 0x43, + 0xE4, 0xBA, 0xBA, 0x43, 0xE4, 0xBB, 0x80, 0x43, + 0xE4, 0xBB, 0x8C, 0x43, 0xE4, 0xBB, 0xA4, 0x43, + // Bytes 740 - 77f + 0xE4, 0xBC, 0x81, 0x43, 0xE4, 0xBC, 0x91, 0x43, + 0xE4, 0xBD, 0xA0, 0x43, 0xE4, 0xBE, 0x80, 0x43, + 0xE4, 0xBE, 0x86, 0x43, 0xE4, 0xBE, 0x8B, 0x43, + 0xE4, 0xBE, 0xAE, 0x43, 0xE4, 0xBE, 0xBB, 0x43, + 0xE4, 0xBE, 0xBF, 0x43, 0xE5, 0x80, 0x82, 0x43, + 0xE5, 0x80, 0xAB, 0x43, 0xE5, 0x81, 0xBA, 0x43, + 0xE5, 0x82, 0x99, 0x43, 0xE5, 0x83, 0x8F, 0x43, + 0xE5, 0x83, 0x9A, 0x43, 0xE5, 0x83, 0xA7, 0x43, + // Bytes 780 - 7bf + 0xE5, 0x84, 0xAA, 0x43, 0xE5, 0x84, 0xBF, 0x43, + 0xE5, 0x85, 0x80, 0x43, 0xE5, 0x85, 0x85, 0x43, + 0xE5, 0x85, 0x8D, 0x43, 0xE5, 0x85, 0x94, 0x43, + 0xE5, 0x85, 0xA4, 0x43, 0xE5, 0x85, 0xA5, 0x43, + 0xE5, 0x85, 0xA7, 0x43, 0xE5, 0x85, 0xA8, 0x43, + 0xE5, 0x85, 0xA9, 0x43, 0xE5, 0x85, 0xAB, 0x43, + 0xE5, 0x85, 0xAD, 0x43, 0xE5, 0x85, 0xB7, 0x43, + 0xE5, 0x86, 0x80, 0x43, 0xE5, 0x86, 0x82, 0x43, + // Bytes 7c0 - 7ff + 0xE5, 0x86, 0x8D, 0x43, 0xE5, 0x86, 0x92, 0x43, + 0xE5, 0x86, 0x95, 0x43, 0xE5, 0x86, 0x96, 0x43, + 0xE5, 0x86, 0x97, 0x43, 0xE5, 0x86, 0x99, 0x43, + 0xE5, 0x86, 0xA4, 0x43, 0xE5, 0x86, 0xAB, 0x43, + 0xE5, 0x86, 0xAC, 0x43, 0xE5, 0x86, 0xB5, 0x43, + 0xE5, 0x86, 0xB7, 0x43, 0xE5, 0x87, 0x89, 0x43, + 0xE5, 0x87, 0x8C, 0x43, 0xE5, 0x87, 0x9C, 0x43, + 0xE5, 0x87, 0x9E, 0x43, 0xE5, 0x87, 0xA0, 0x43, + // Bytes 800 - 83f + 0xE5, 0x87, 0xB5, 0x43, 0xE5, 0x88, 0x80, 0x43, + 0xE5, 0x88, 0x83, 0x43, 0xE5, 0x88, 0x87, 0x43, + 0xE5, 0x88, 0x97, 0x43, 0xE5, 0x88, 0x9D, 0x43, + 0xE5, 0x88, 0xA9, 0x43, 0xE5, 0x88, 0xBA, 0x43, + 0xE5, 0x88, 0xBB, 0x43, 0xE5, 0x89, 0x86, 0x43, + 0xE5, 0x89, 0x8D, 0x43, 0xE5, 0x89, 0xB2, 0x43, + 0xE5, 0x89, 0xB7, 0x43, 0xE5, 0x8A, 0x89, 0x43, + 0xE5, 0x8A, 0x9B, 0x43, 0xE5, 0x8A, 0xA3, 0x43, + // Bytes 840 - 87f + 0xE5, 0x8A, 0xB3, 0x43, 0xE5, 0x8A, 0xB4, 0x43, + 0xE5, 0x8B, 0x87, 0x43, 0xE5, 0x8B, 0x89, 0x43, + 0xE5, 0x8B, 0x92, 0x43, 0xE5, 0x8B, 0x9E, 0x43, + 0xE5, 0x8B, 0xA4, 0x43, 0xE5, 0x8B, 0xB5, 0x43, + 0xE5, 0x8B, 0xB9, 0x43, 0xE5, 0x8B, 0xBA, 0x43, + 0xE5, 0x8C, 0x85, 0x43, 0xE5, 0x8C, 0x86, 0x43, + 0xE5, 0x8C, 0x95, 0x43, 0xE5, 0x8C, 0x97, 0x43, + 0xE5, 0x8C, 0x9A, 0x43, 0xE5, 0x8C, 0xB8, 0x43, + // Bytes 880 - 8bf + 0xE5, 0x8C, 0xBB, 0x43, 0xE5, 0x8C, 0xBF, 0x43, + 0xE5, 0x8D, 0x81, 0x43, 0xE5, 0x8D, 0x84, 0x43, + 0xE5, 0x8D, 0x85, 0x43, 0xE5, 0x8D, 0x89, 0x43, + 0xE5, 0x8D, 0x91, 0x43, 0xE5, 0x8D, 0x94, 0x43, + 0xE5, 0x8D, 0x9A, 0x43, 0xE5, 0x8D, 0x9C, 0x43, + 0xE5, 0x8D, 0xA9, 0x43, 0xE5, 0x8D, 0xB0, 0x43, + 0xE5, 0x8D, 0xB3, 0x43, 0xE5, 0x8D, 0xB5, 0x43, + 0xE5, 0x8D, 0xBD, 0x43, 0xE5, 0x8D, 0xBF, 0x43, + // Bytes 8c0 - 8ff + 0xE5, 0x8E, 0x82, 0x43, 0xE5, 0x8E, 0xB6, 0x43, + 0xE5, 0x8F, 0x83, 0x43, 0xE5, 0x8F, 0x88, 0x43, + 0xE5, 0x8F, 0x8A, 0x43, 0xE5, 0x8F, 0x8C, 0x43, + 0xE5, 0x8F, 0x9F, 0x43, 0xE5, 0x8F, 0xA3, 0x43, + 0xE5, 0x8F, 0xA5, 0x43, 0xE5, 0x8F, 0xAB, 0x43, + 0xE5, 0x8F, 0xAF, 0x43, 0xE5, 0x8F, 0xB1, 0x43, + 0xE5, 0x8F, 0xB3, 0x43, 0xE5, 0x90, 0x86, 0x43, + 0xE5, 0x90, 0x88, 0x43, 0xE5, 0x90, 0x8D, 0x43, + // Bytes 900 - 93f + 0xE5, 0x90, 0x8F, 0x43, 0xE5, 0x90, 0x9D, 0x43, + 0xE5, 0x90, 0xB8, 0x43, 0xE5, 0x90, 0xB9, 0x43, + 0xE5, 0x91, 0x82, 0x43, 0xE5, 0x91, 0x88, 0x43, + 0xE5, 0x91, 0xA8, 0x43, 0xE5, 0x92, 0x9E, 0x43, + 0xE5, 0x92, 0xA2, 0x43, 0xE5, 0x92, 0xBD, 0x43, + 0xE5, 0x93, 0xB6, 0x43, 0xE5, 0x94, 0x90, 0x43, + 0xE5, 0x95, 0x8F, 0x43, 0xE5, 0x95, 0x93, 0x43, + 0xE5, 0x95, 0x95, 0x43, 0xE5, 0x95, 0xA3, 0x43, + // Bytes 940 - 97f + 0xE5, 0x96, 0x84, 0x43, 0xE5, 0x96, 0x87, 0x43, + 0xE5, 0x96, 0x99, 0x43, 0xE5, 0x96, 0x9D, 0x43, + 0xE5, 0x96, 0xAB, 0x43, 0xE5, 0x96, 0xB3, 0x43, + 0xE5, 0x96, 0xB6, 0x43, 0xE5, 0x97, 0x80, 0x43, + 0xE5, 0x97, 0x82, 0x43, 0xE5, 0x97, 0xA2, 0x43, + 0xE5, 0x98, 0x86, 0x43, 0xE5, 0x99, 0x91, 0x43, + 0xE5, 0x99, 0xA8, 0x43, 0xE5, 0x99, 0xB4, 0x43, + 0xE5, 0x9B, 0x97, 0x43, 0xE5, 0x9B, 0x9B, 0x43, + // Bytes 980 - 9bf + 0xE5, 0x9B, 0xB9, 0x43, 0xE5, 0x9C, 0x96, 0x43, + 0xE5, 0x9C, 0x97, 0x43, 0xE5, 0x9C, 0x9F, 0x43, + 0xE5, 0x9C, 0xB0, 0x43, 0xE5, 0x9E, 0x8B, 0x43, + 0xE5, 0x9F, 0x8E, 0x43, 0xE5, 0x9F, 0xB4, 0x43, + 0xE5, 0xA0, 0x8D, 0x43, 0xE5, 0xA0, 0xB1, 0x43, + 0xE5, 0xA0, 0xB2, 0x43, 0xE5, 0xA1, 0x80, 0x43, + 0xE5, 0xA1, 0x9A, 0x43, 0xE5, 0xA1, 0x9E, 0x43, + 0xE5, 0xA2, 0xA8, 0x43, 0xE5, 0xA2, 0xAC, 0x43, + // Bytes 9c0 - 9ff + 0xE5, 0xA2, 0xB3, 0x43, 0xE5, 0xA3, 0x98, 0x43, + 0xE5, 0xA3, 0x9F, 0x43, 0xE5, 0xA3, 0xAB, 0x43, + 0xE5, 0xA3, 0xAE, 0x43, 0xE5, 0xA3, 0xB0, 0x43, + 0xE5, 0xA3, 0xB2, 0x43, 0xE5, 0xA3, 0xB7, 0x43, + 0xE5, 0xA4, 0x82, 0x43, 0xE5, 0xA4, 0x86, 0x43, + 0xE5, 0xA4, 0x8A, 0x43, 0xE5, 0xA4, 0x95, 0x43, + 0xE5, 0xA4, 0x9A, 0x43, 0xE5, 0xA4, 0x9C, 0x43, + 0xE5, 0xA4, 0xA2, 0x43, 0xE5, 0xA4, 0xA7, 0x43, + // Bytes a00 - a3f + 0xE5, 0xA4, 0xA9, 0x43, 0xE5, 0xA5, 0x84, 0x43, + 0xE5, 0xA5, 0x88, 0x43, 0xE5, 0xA5, 0x91, 0x43, + 0xE5, 0xA5, 0x94, 0x43, 0xE5, 0xA5, 0xA2, 0x43, + 0xE5, 0xA5, 0xB3, 0x43, 0xE5, 0xA7, 0x98, 0x43, + 0xE5, 0xA7, 0xAC, 0x43, 0xE5, 0xA8, 0x9B, 0x43, + 0xE5, 0xA8, 0xA7, 0x43, 0xE5, 0xA9, 0xA2, 0x43, + 0xE5, 0xA9, 0xA6, 0x43, 0xE5, 0xAA, 0xB5, 0x43, + 0xE5, 0xAC, 0x88, 0x43, 0xE5, 0xAC, 0xA8, 0x43, + // Bytes a40 - a7f + 0xE5, 0xAC, 0xBE, 0x43, 0xE5, 0xAD, 0x90, 0x43, + 0xE5, 0xAD, 0x97, 0x43, 0xE5, 0xAD, 0xA6, 0x43, + 0xE5, 0xAE, 0x80, 0x43, 0xE5, 0xAE, 0x85, 0x43, + 0xE5, 0xAE, 0x97, 0x43, 0xE5, 0xAF, 0x83, 0x43, + 0xE5, 0xAF, 0x98, 0x43, 0xE5, 0xAF, 0xA7, 0x43, + 0xE5, 0xAF, 0xAE, 0x43, 0xE5, 0xAF, 0xB3, 0x43, + 0xE5, 0xAF, 0xB8, 0x43, 0xE5, 0xAF, 0xBF, 0x43, + 0xE5, 0xB0, 0x86, 0x43, 0xE5, 0xB0, 0x8F, 0x43, + // Bytes a80 - abf + 0xE5, 0xB0, 0xA2, 0x43, 0xE5, 0xB0, 0xB8, 0x43, + 0xE5, 0xB0, 0xBF, 0x43, 0xE5, 0xB1, 0xA0, 0x43, + 0xE5, 0xB1, 0xA2, 0x43, 0xE5, 0xB1, 0xA4, 0x43, + 0xE5, 0xB1, 0xA5, 0x43, 0xE5, 0xB1, 0xAE, 0x43, + 0xE5, 0xB1, 0xB1, 0x43, 0xE5, 0xB2, 0x8D, 0x43, + 0xE5, 0xB3, 0x80, 0x43, 0xE5, 0xB4, 0x99, 0x43, + 0xE5, 0xB5, 0x83, 0x43, 0xE5, 0xB5, 0x90, 0x43, + 0xE5, 0xB5, 0xAB, 0x43, 0xE5, 0xB5, 0xAE, 0x43, + // Bytes ac0 - aff + 0xE5, 0xB5, 0xBC, 0x43, 0xE5, 0xB6, 0xB2, 0x43, + 0xE5, 0xB6, 0xBA, 0x43, 0xE5, 0xB7, 0x9B, 0x43, + 0xE5, 0xB7, 0xA1, 0x43, 0xE5, 0xB7, 0xA2, 0x43, + 0xE5, 0xB7, 0xA5, 0x43, 0xE5, 0xB7, 0xA6, 0x43, + 0xE5, 0xB7, 0xB1, 0x43, 0xE5, 0xB7, 0xBD, 0x43, + 0xE5, 0xB7, 0xBE, 0x43, 0xE5, 0xB8, 0xA8, 0x43, + 0xE5, 0xB8, 0xBD, 0x43, 0xE5, 0xB9, 0xA9, 0x43, + 0xE5, 0xB9, 0xB2, 0x43, 0xE5, 0xB9, 0xB4, 0x43, + // Bytes b00 - b3f + 0xE5, 0xB9, 0xBA, 0x43, 0xE5, 0xB9, 0xBC, 0x43, + 0xE5, 0xB9, 0xBF, 0x43, 0xE5, 0xBA, 0xA6, 0x43, + 0xE5, 0xBA, 0xB0, 0x43, 0xE5, 0xBA, 0xB3, 0x43, + 0xE5, 0xBA, 0xB6, 0x43, 0xE5, 0xBB, 0x89, 0x43, + 0xE5, 0xBB, 0x8A, 0x43, 0xE5, 0xBB, 0x92, 0x43, + 0xE5, 0xBB, 0x93, 0x43, 0xE5, 0xBB, 0x99, 0x43, + 0xE5, 0xBB, 0xAC, 0x43, 0xE5, 0xBB, 0xB4, 0x43, + 0xE5, 0xBB, 0xBE, 0x43, 0xE5, 0xBC, 0x84, 0x43, + // Bytes b40 - b7f + 0xE5, 0xBC, 0x8B, 0x43, 0xE5, 0xBC, 0x93, 0x43, + 0xE5, 0xBC, 0xA2, 0x43, 0xE5, 0xBD, 0x90, 0x43, + 0xE5, 0xBD, 0x93, 0x43, 0xE5, 0xBD, 0xA1, 0x43, + 0xE5, 0xBD, 0xA2, 0x43, 0xE5, 0xBD, 0xA9, 0x43, + 0xE5, 0xBD, 0xAB, 0x43, 0xE5, 0xBD, 0xB3, 0x43, + 0xE5, 0xBE, 0x8B, 0x43, 0xE5, 0xBE, 0x8C, 0x43, + 0xE5, 0xBE, 0x97, 0x43, 0xE5, 0xBE, 0x9A, 0x43, + 0xE5, 0xBE, 0xA9, 0x43, 0xE5, 0xBE, 0xAD, 0x43, + // Bytes b80 - bbf + 0xE5, 0xBF, 0x83, 0x43, 0xE5, 0xBF, 0x8D, 0x43, + 0xE5, 0xBF, 0x97, 0x43, 0xE5, 0xBF, 0xB5, 0x43, + 0xE5, 0xBF, 0xB9, 0x43, 0xE6, 0x80, 0x92, 0x43, + 0xE6, 0x80, 0x9C, 0x43, 0xE6, 0x81, 0xB5, 0x43, + 0xE6, 0x82, 0x81, 0x43, 0xE6, 0x82, 0x94, 0x43, + 0xE6, 0x83, 0x87, 0x43, 0xE6, 0x83, 0x98, 0x43, + 0xE6, 0x83, 0xA1, 0x43, 0xE6, 0x84, 0x88, 0x43, + 0xE6, 0x85, 0x84, 0x43, 0xE6, 0x85, 0x88, 0x43, + // Bytes bc0 - bff + 0xE6, 0x85, 0x8C, 0x43, 0xE6, 0x85, 0x8E, 0x43, + 0xE6, 0x85, 0xA0, 0x43, 0xE6, 0x85, 0xA8, 0x43, + 0xE6, 0x85, 0xBA, 0x43, 0xE6, 0x86, 0x8E, 0x43, + 0xE6, 0x86, 0x90, 0x43, 0xE6, 0x86, 0xA4, 0x43, + 0xE6, 0x86, 0xAF, 0x43, 0xE6, 0x86, 0xB2, 0x43, + 0xE6, 0x87, 0x9E, 0x43, 0xE6, 0x87, 0xB2, 0x43, + 0xE6, 0x87, 0xB6, 0x43, 0xE6, 0x88, 0x80, 0x43, + 0xE6, 0x88, 0x88, 0x43, 0xE6, 0x88, 0x90, 0x43, + // Bytes c00 - c3f + 0xE6, 0x88, 0x9B, 0x43, 0xE6, 0x88, 0xAE, 0x43, + 0xE6, 0x88, 0xB4, 0x43, 0xE6, 0x88, 0xB6, 0x43, + 0xE6, 0x89, 0x8B, 0x43, 0xE6, 0x89, 0x93, 0x43, + 0xE6, 0x89, 0x9D, 0x43, 0xE6, 0x8A, 0x95, 0x43, + 0xE6, 0x8A, 0xB1, 0x43, 0xE6, 0x8B, 0x89, 0x43, + 0xE6, 0x8B, 0x8F, 0x43, 0xE6, 0x8B, 0x93, 0x43, + 0xE6, 0x8B, 0x94, 0x43, 0xE6, 0x8B, 0xBC, 0x43, + 0xE6, 0x8B, 0xBE, 0x43, 0xE6, 0x8C, 0x87, 0x43, + // Bytes c40 - c7f + 0xE6, 0x8C, 0xBD, 0x43, 0xE6, 0x8D, 0x90, 0x43, + 0xE6, 0x8D, 0x95, 0x43, 0xE6, 0x8D, 0xA8, 0x43, + 0xE6, 0x8D, 0xBB, 0x43, 0xE6, 0x8E, 0x83, 0x43, + 0xE6, 0x8E, 0xA0, 0x43, 0xE6, 0x8E, 0xA9, 0x43, + 0xE6, 0x8F, 0x84, 0x43, 0xE6, 0x8F, 0x85, 0x43, + 0xE6, 0x8F, 0xA4, 0x43, 0xE6, 0x90, 0x9C, 0x43, + 0xE6, 0x90, 0xA2, 0x43, 0xE6, 0x91, 0x92, 0x43, + 0xE6, 0x91, 0xA9, 0x43, 0xE6, 0x91, 0xB7, 0x43, + // Bytes c80 - cbf + 0xE6, 0x91, 0xBE, 0x43, 0xE6, 0x92, 0x9A, 0x43, + 0xE6, 0x92, 0x9D, 0x43, 0xE6, 0x93, 0x84, 0x43, + 0xE6, 0x94, 0xAF, 0x43, 0xE6, 0x94, 0xB4, 0x43, + 0xE6, 0x95, 0x8F, 0x43, 0xE6, 0x95, 0x96, 0x43, + 0xE6, 0x95, 0xAC, 0x43, 0xE6, 0x95, 0xB8, 0x43, + 0xE6, 0x96, 0x87, 0x43, 0xE6, 0x96, 0x97, 0x43, + 0xE6, 0x96, 0x99, 0x43, 0xE6, 0x96, 0xA4, 0x43, + 0xE6, 0x96, 0xB0, 0x43, 0xE6, 0x96, 0xB9, 0x43, + // Bytes cc0 - cff + 0xE6, 0x97, 0x85, 0x43, 0xE6, 0x97, 0xA0, 0x43, + 0xE6, 0x97, 0xA2, 0x43, 0xE6, 0x97, 0xA3, 0x43, + 0xE6, 0x97, 0xA5, 0x43, 0xE6, 0x98, 0x93, 0x43, + 0xE6, 0x98, 0xA0, 0x43, 0xE6, 0x99, 0x89, 0x43, + 0xE6, 0x99, 0xB4, 0x43, 0xE6, 0x9A, 0x88, 0x43, + 0xE6, 0x9A, 0x91, 0x43, 0xE6, 0x9A, 0x9C, 0x43, + 0xE6, 0x9A, 0xB4, 0x43, 0xE6, 0x9B, 0x86, 0x43, + 0xE6, 0x9B, 0xB0, 0x43, 0xE6, 0x9B, 0xB4, 0x43, + // Bytes d00 - d3f + 0xE6, 0x9B, 0xB8, 0x43, 0xE6, 0x9C, 0x80, 0x43, + 0xE6, 0x9C, 0x88, 0x43, 0xE6, 0x9C, 0x89, 0x43, + 0xE6, 0x9C, 0x97, 0x43, 0xE6, 0x9C, 0x9B, 0x43, + 0xE6, 0x9C, 0xA1, 0x43, 0xE6, 0x9C, 0xA8, 0x43, + 0xE6, 0x9D, 0x8E, 0x43, 0xE6, 0x9D, 0x93, 0x43, + 0xE6, 0x9D, 0x96, 0x43, 0xE6, 0x9D, 0x9E, 0x43, + 0xE6, 0x9D, 0xBB, 0x43, 0xE6, 0x9E, 0x85, 0x43, + 0xE6, 0x9E, 0x97, 0x43, 0xE6, 0x9F, 0xB3, 0x43, + // Bytes d40 - d7f + 0xE6, 0x9F, 0xBA, 0x43, 0xE6, 0xA0, 0x97, 0x43, + 0xE6, 0xA0, 0x9F, 0x43, 0xE6, 0xA0, 0xAA, 0x43, + 0xE6, 0xA1, 0x92, 0x43, 0xE6, 0xA2, 0x81, 0x43, + 0xE6, 0xA2, 0x85, 0x43, 0xE6, 0xA2, 0x8E, 0x43, + 0xE6, 0xA2, 0xA8, 0x43, 0xE6, 0xA4, 0x94, 0x43, + 0xE6, 0xA5, 0x82, 0x43, 0xE6, 0xA6, 0xA3, 0x43, + 0xE6, 0xA7, 0xAA, 0x43, 0xE6, 0xA8, 0x82, 0x43, + 0xE6, 0xA8, 0x93, 0x43, 0xE6, 0xAA, 0xA8, 0x43, + // Bytes d80 - dbf + 0xE6, 0xAB, 0x93, 0x43, 0xE6, 0xAB, 0x9B, 0x43, + 0xE6, 0xAC, 0x84, 0x43, 0xE6, 0xAC, 0xA0, 0x43, + 0xE6, 0xAC, 0xA1, 0x43, 0xE6, 0xAD, 0x94, 0x43, + 0xE6, 0xAD, 0xA2, 0x43, 0xE6, 0xAD, 0xA3, 0x43, + 0xE6, 0xAD, 0xB2, 0x43, 0xE6, 0xAD, 0xB7, 0x43, + 0xE6, 0xAD, 0xB9, 0x43, 0xE6, 0xAE, 0x9F, 0x43, + 0xE6, 0xAE, 0xAE, 0x43, 0xE6, 0xAE, 0xB3, 0x43, + 0xE6, 0xAE, 0xBA, 0x43, 0xE6, 0xAE, 0xBB, 0x43, + // Bytes dc0 - dff + 0xE6, 0xAF, 0x8B, 0x43, 0xE6, 0xAF, 0x8D, 0x43, + 0xE6, 0xAF, 0x94, 0x43, 0xE6, 0xAF, 0x9B, 0x43, + 0xE6, 0xB0, 0x8F, 0x43, 0xE6, 0xB0, 0x94, 0x43, + 0xE6, 0xB0, 0xB4, 0x43, 0xE6, 0xB1, 0x8E, 0x43, + 0xE6, 0xB1, 0xA7, 0x43, 0xE6, 0xB2, 0x88, 0x43, + 0xE6, 0xB2, 0xBF, 0x43, 0xE6, 0xB3, 0x8C, 0x43, + 0xE6, 0xB3, 0x8D, 0x43, 0xE6, 0xB3, 0xA5, 0x43, + 0xE6, 0xB3, 0xA8, 0x43, 0xE6, 0xB4, 0x96, 0x43, + // Bytes e00 - e3f + 0xE6, 0xB4, 0x9B, 0x43, 0xE6, 0xB4, 0x9E, 0x43, + 0xE6, 0xB4, 0xB4, 0x43, 0xE6, 0xB4, 0xBE, 0x43, + 0xE6, 0xB5, 0x81, 0x43, 0xE6, 0xB5, 0xA9, 0x43, + 0xE6, 0xB5, 0xAA, 0x43, 0xE6, 0xB5, 0xB7, 0x43, + 0xE6, 0xB5, 0xB8, 0x43, 0xE6, 0xB6, 0x85, 0x43, + 0xE6, 0xB7, 0x8B, 0x43, 0xE6, 0xB7, 0x9A, 0x43, + 0xE6, 0xB7, 0xAA, 0x43, 0xE6, 0xB7, 0xB9, 0x43, + 0xE6, 0xB8, 0x9A, 0x43, 0xE6, 0xB8, 0xAF, 0x43, + // Bytes e40 - e7f + 0xE6, 0xB9, 0xAE, 0x43, 0xE6, 0xBA, 0x80, 0x43, + 0xE6, 0xBA, 0x9C, 0x43, 0xE6, 0xBA, 0xBA, 0x43, + 0xE6, 0xBB, 0x87, 0x43, 0xE6, 0xBB, 0x8B, 0x43, + 0xE6, 0xBB, 0x91, 0x43, 0xE6, 0xBB, 0x9B, 0x43, + 0xE6, 0xBC, 0x8F, 0x43, 0xE6, 0xBC, 0x94, 0x43, + 0xE6, 0xBC, 0xA2, 0x43, 0xE6, 0xBC, 0xA3, 0x43, + 0xE6, 0xBD, 0xAE, 0x43, 0xE6, 0xBF, 0x86, 0x43, + 0xE6, 0xBF, 0xAB, 0x43, 0xE6, 0xBF, 0xBE, 0x43, + // Bytes e80 - ebf + 0xE7, 0x80, 0x9B, 0x43, 0xE7, 0x80, 0x9E, 0x43, + 0xE7, 0x80, 0xB9, 0x43, 0xE7, 0x81, 0x8A, 0x43, + 0xE7, 0x81, 0xAB, 0x43, 0xE7, 0x81, 0xB0, 0x43, + 0xE7, 0x81, 0xB7, 0x43, 0xE7, 0x81, 0xBD, 0x43, + 0xE7, 0x82, 0x99, 0x43, 0xE7, 0x82, 0xAD, 0x43, + 0xE7, 0x83, 0x88, 0x43, 0xE7, 0x83, 0x99, 0x43, + 0xE7, 0x84, 0xA1, 0x43, 0xE7, 0x85, 0x85, 0x43, + 0xE7, 0x85, 0x89, 0x43, 0xE7, 0x85, 0xAE, 0x43, + // Bytes ec0 - eff + 0xE7, 0x86, 0x9C, 0x43, 0xE7, 0x87, 0x8E, 0x43, + 0xE7, 0x87, 0x90, 0x43, 0xE7, 0x88, 0x90, 0x43, + 0xE7, 0x88, 0x9B, 0x43, 0xE7, 0x88, 0xA8, 0x43, + 0xE7, 0x88, 0xAA, 0x43, 0xE7, 0x88, 0xAB, 0x43, + 0xE7, 0x88, 0xB5, 0x43, 0xE7, 0x88, 0xB6, 0x43, + 0xE7, 0x88, 0xBB, 0x43, 0xE7, 0x88, 0xBF, 0x43, + 0xE7, 0x89, 0x87, 0x43, 0xE7, 0x89, 0x90, 0x43, + 0xE7, 0x89, 0x99, 0x43, 0xE7, 0x89, 0x9B, 0x43, + // Bytes f00 - f3f + 0xE7, 0x89, 0xA2, 0x43, 0xE7, 0x89, 0xB9, 0x43, + 0xE7, 0x8A, 0x80, 0x43, 0xE7, 0x8A, 0x95, 0x43, + 0xE7, 0x8A, 0xAC, 0x43, 0xE7, 0x8A, 0xAF, 0x43, + 0xE7, 0x8B, 0x80, 0x43, 0xE7, 0x8B, 0xBC, 0x43, + 0xE7, 0x8C, 0xAA, 0x43, 0xE7, 0x8D, 0xB5, 0x43, + 0xE7, 0x8D, 0xBA, 0x43, 0xE7, 0x8E, 0x84, 0x43, + 0xE7, 0x8E, 0x87, 0x43, 0xE7, 0x8E, 0x89, 0x43, + 0xE7, 0x8E, 0x8B, 0x43, 0xE7, 0x8E, 0xA5, 0x43, + // Bytes f40 - f7f + 0xE7, 0x8E, 0xB2, 0x43, 0xE7, 0x8F, 0x9E, 0x43, + 0xE7, 0x90, 0x86, 0x43, 0xE7, 0x90, 0x89, 0x43, + 0xE7, 0x90, 0xA2, 0x43, 0xE7, 0x91, 0x87, 0x43, + 0xE7, 0x91, 0x9C, 0x43, 0xE7, 0x91, 0xA9, 0x43, + 0xE7, 0x91, 0xB1, 0x43, 0xE7, 0x92, 0x85, 0x43, + 0xE7, 0x92, 0x89, 0x43, 0xE7, 0x92, 0x98, 0x43, + 0xE7, 0x93, 0x8A, 0x43, 0xE7, 0x93, 0x9C, 0x43, + 0xE7, 0x93, 0xA6, 0x43, 0xE7, 0x94, 0x86, 0x43, + // Bytes f80 - fbf + 0xE7, 0x94, 0x98, 0x43, 0xE7, 0x94, 0x9F, 0x43, + 0xE7, 0x94, 0xA4, 0x43, 0xE7, 0x94, 0xA8, 0x43, + 0xE7, 0x94, 0xB0, 0x43, 0xE7, 0x94, 0xB2, 0x43, + 0xE7, 0x94, 0xB3, 0x43, 0xE7, 0x94, 0xB7, 0x43, + 0xE7, 0x94, 0xBB, 0x43, 0xE7, 0x94, 0xBE, 0x43, + 0xE7, 0x95, 0x99, 0x43, 0xE7, 0x95, 0xA5, 0x43, + 0xE7, 0x95, 0xB0, 0x43, 0xE7, 0x96, 0x8B, 0x43, + 0xE7, 0x96, 0x92, 0x43, 0xE7, 0x97, 0xA2, 0x43, + // Bytes fc0 - fff + 0xE7, 0x98, 0x90, 0x43, 0xE7, 0x98, 0x9D, 0x43, + 0xE7, 0x98, 0x9F, 0x43, 0xE7, 0x99, 0x82, 0x43, + 0xE7, 0x99, 0xA9, 0x43, 0xE7, 0x99, 0xB6, 0x43, + 0xE7, 0x99, 0xBD, 0x43, 0xE7, 0x9A, 0xAE, 0x43, + 0xE7, 0x9A, 0xBF, 0x43, 0xE7, 0x9B, 0x8A, 0x43, + 0xE7, 0x9B, 0x9B, 0x43, 0xE7, 0x9B, 0xA3, 0x43, + 0xE7, 0x9B, 0xA7, 0x43, 0xE7, 0x9B, 0xAE, 0x43, + 0xE7, 0x9B, 0xB4, 0x43, 0xE7, 0x9C, 0x81, 0x43, + // Bytes 1000 - 103f + 0xE7, 0x9C, 0x9E, 0x43, 0xE7, 0x9C, 0x9F, 0x43, + 0xE7, 0x9D, 0x80, 0x43, 0xE7, 0x9D, 0x8A, 0x43, + 0xE7, 0x9E, 0x8B, 0x43, 0xE7, 0x9E, 0xA7, 0x43, + 0xE7, 0x9F, 0x9B, 0x43, 0xE7, 0x9F, 0xA2, 0x43, + 0xE7, 0x9F, 0xB3, 0x43, 0xE7, 0xA1, 0x8E, 0x43, + 0xE7, 0xA1, 0xAB, 0x43, 0xE7, 0xA2, 0x8C, 0x43, + 0xE7, 0xA2, 0x91, 0x43, 0xE7, 0xA3, 0x8A, 0x43, + 0xE7, 0xA3, 0x8C, 0x43, 0xE7, 0xA3, 0xBB, 0x43, + // Bytes 1040 - 107f + 0xE7, 0xA4, 0xAA, 0x43, 0xE7, 0xA4, 0xBA, 0x43, + 0xE7, 0xA4, 0xBC, 0x43, 0xE7, 0xA4, 0xBE, 0x43, + 0xE7, 0xA5, 0x88, 0x43, 0xE7, 0xA5, 0x89, 0x43, + 0xE7, 0xA5, 0x90, 0x43, 0xE7, 0xA5, 0x96, 0x43, + 0xE7, 0xA5, 0x9D, 0x43, 0xE7, 0xA5, 0x9E, 0x43, + 0xE7, 0xA5, 0xA5, 0x43, 0xE7, 0xA5, 0xBF, 0x43, + 0xE7, 0xA6, 0x81, 0x43, 0xE7, 0xA6, 0x8D, 0x43, + 0xE7, 0xA6, 0x8E, 0x43, 0xE7, 0xA6, 0x8F, 0x43, + // Bytes 1080 - 10bf + 0xE7, 0xA6, 0xAE, 0x43, 0xE7, 0xA6, 0xB8, 0x43, + 0xE7, 0xA6, 0xBE, 0x43, 0xE7, 0xA7, 0x8A, 0x43, + 0xE7, 0xA7, 0x98, 0x43, 0xE7, 0xA7, 0xAB, 0x43, + 0xE7, 0xA8, 0x9C, 0x43, 0xE7, 0xA9, 0x80, 0x43, + 0xE7, 0xA9, 0x8A, 0x43, 0xE7, 0xA9, 0x8F, 0x43, + 0xE7, 0xA9, 0xB4, 0x43, 0xE7, 0xA9, 0xBA, 0x43, + 0xE7, 0xAA, 0x81, 0x43, 0xE7, 0xAA, 0xB1, 0x43, + 0xE7, 0xAB, 0x8B, 0x43, 0xE7, 0xAB, 0xAE, 0x43, + // Bytes 10c0 - 10ff + 0xE7, 0xAB, 0xB9, 0x43, 0xE7, 0xAC, 0xA0, 0x43, + 0xE7, 0xAE, 0x8F, 0x43, 0xE7, 0xAF, 0x80, 0x43, + 0xE7, 0xAF, 0x86, 0x43, 0xE7, 0xAF, 0x89, 0x43, + 0xE7, 0xB0, 0xBE, 0x43, 0xE7, 0xB1, 0xA0, 0x43, + 0xE7, 0xB1, 0xB3, 0x43, 0xE7, 0xB1, 0xBB, 0x43, + 0xE7, 0xB2, 0x92, 0x43, 0xE7, 0xB2, 0xBE, 0x43, + 0xE7, 0xB3, 0x92, 0x43, 0xE7, 0xB3, 0x96, 0x43, + 0xE7, 0xB3, 0xA3, 0x43, 0xE7, 0xB3, 0xA7, 0x43, + // Bytes 1100 - 113f + 0xE7, 0xB3, 0xA8, 0x43, 0xE7, 0xB3, 0xB8, 0x43, + 0xE7, 0xB4, 0x80, 0x43, 0xE7, 0xB4, 0x90, 0x43, + 0xE7, 0xB4, 0xA2, 0x43, 0xE7, 0xB4, 0xAF, 0x43, + 0xE7, 0xB5, 0x82, 0x43, 0xE7, 0xB5, 0x9B, 0x43, + 0xE7, 0xB5, 0xA3, 0x43, 0xE7, 0xB6, 0xA0, 0x43, + 0xE7, 0xB6, 0xBE, 0x43, 0xE7, 0xB7, 0x87, 0x43, + 0xE7, 0xB7, 0xB4, 0x43, 0xE7, 0xB8, 0x82, 0x43, + 0xE7, 0xB8, 0x89, 0x43, 0xE7, 0xB8, 0xB7, 0x43, + // Bytes 1140 - 117f + 0xE7, 0xB9, 0x81, 0x43, 0xE7, 0xB9, 0x85, 0x43, + 0xE7, 0xBC, 0xB6, 0x43, 0xE7, 0xBC, 0xBE, 0x43, + 0xE7, 0xBD, 0x91, 0x43, 0xE7, 0xBD, 0xB2, 0x43, + 0xE7, 0xBD, 0xB9, 0x43, 0xE7, 0xBD, 0xBA, 0x43, + 0xE7, 0xBE, 0x85, 0x43, 0xE7, 0xBE, 0x8A, 0x43, + 0xE7, 0xBE, 0x95, 0x43, 0xE7, 0xBE, 0x9A, 0x43, + 0xE7, 0xBE, 0xBD, 0x43, 0xE7, 0xBF, 0xBA, 0x43, + 0xE8, 0x80, 0x81, 0x43, 0xE8, 0x80, 0x85, 0x43, + // Bytes 1180 - 11bf + 0xE8, 0x80, 0x8C, 0x43, 0xE8, 0x80, 0x92, 0x43, + 0xE8, 0x80, 0xB3, 0x43, 0xE8, 0x81, 0x86, 0x43, + 0xE8, 0x81, 0xA0, 0x43, 0xE8, 0x81, 0xAF, 0x43, + 0xE8, 0x81, 0xB0, 0x43, 0xE8, 0x81, 0xBE, 0x43, + 0xE8, 0x81, 0xBF, 0x43, 0xE8, 0x82, 0x89, 0x43, + 0xE8, 0x82, 0x8B, 0x43, 0xE8, 0x82, 0xAD, 0x43, + 0xE8, 0x82, 0xB2, 0x43, 0xE8, 0x84, 0x83, 0x43, + 0xE8, 0x84, 0xBE, 0x43, 0xE8, 0x87, 0x98, 0x43, + // Bytes 11c0 - 11ff + 0xE8, 0x87, 0xA3, 0x43, 0xE8, 0x87, 0xA8, 0x43, + 0xE8, 0x87, 0xAA, 0x43, 0xE8, 0x87, 0xAD, 0x43, + 0xE8, 0x87, 0xB3, 0x43, 0xE8, 0x87, 0xBC, 0x43, + 0xE8, 0x88, 0x81, 0x43, 0xE8, 0x88, 0x84, 0x43, + 0xE8, 0x88, 0x8C, 0x43, 0xE8, 0x88, 0x98, 0x43, + 0xE8, 0x88, 0x9B, 0x43, 0xE8, 0x88, 0x9F, 0x43, + 0xE8, 0x89, 0xAE, 0x43, 0xE8, 0x89, 0xAF, 0x43, + 0xE8, 0x89, 0xB2, 0x43, 0xE8, 0x89, 0xB8, 0x43, + // Bytes 1200 - 123f + 0xE8, 0x89, 0xB9, 0x43, 0xE8, 0x8A, 0x8B, 0x43, + 0xE8, 0x8A, 0x91, 0x43, 0xE8, 0x8A, 0x9D, 0x43, + 0xE8, 0x8A, 0xB1, 0x43, 0xE8, 0x8A, 0xB3, 0x43, + 0xE8, 0x8A, 0xBD, 0x43, 0xE8, 0x8B, 0xA5, 0x43, + 0xE8, 0x8B, 0xA6, 0x43, 0xE8, 0x8C, 0x9D, 0x43, + 0xE8, 0x8C, 0xA3, 0x43, 0xE8, 0x8C, 0xB6, 0x43, + 0xE8, 0x8D, 0x92, 0x43, 0xE8, 0x8D, 0x93, 0x43, + 0xE8, 0x8D, 0xA3, 0x43, 0xE8, 0x8E, 0xAD, 0x43, + // Bytes 1240 - 127f + 0xE8, 0x8E, 0xBD, 0x43, 0xE8, 0x8F, 0x89, 0x43, + 0xE8, 0x8F, 0x8A, 0x43, 0xE8, 0x8F, 0x8C, 0x43, + 0xE8, 0x8F, 0x9C, 0x43, 0xE8, 0x8F, 0xA7, 0x43, + 0xE8, 0x8F, 0xAF, 0x43, 0xE8, 0x8F, 0xB1, 0x43, + 0xE8, 0x90, 0xBD, 0x43, 0xE8, 0x91, 0x89, 0x43, + 0xE8, 0x91, 0x97, 0x43, 0xE8, 0x93, 0xAE, 0x43, + 0xE8, 0x93, 0xB1, 0x43, 0xE8, 0x93, 0xB3, 0x43, + 0xE8, 0x93, 0xBC, 0x43, 0xE8, 0x94, 0x96, 0x43, + // Bytes 1280 - 12bf + 0xE8, 0x95, 0xA4, 0x43, 0xE8, 0x97, 0x8D, 0x43, + 0xE8, 0x97, 0xBA, 0x43, 0xE8, 0x98, 0x86, 0x43, + 0xE8, 0x98, 0x92, 0x43, 0xE8, 0x98, 0xAD, 0x43, + 0xE8, 0x98, 0xBF, 0x43, 0xE8, 0x99, 0x8D, 0x43, + 0xE8, 0x99, 0x90, 0x43, 0xE8, 0x99, 0x9C, 0x43, + 0xE8, 0x99, 0xA7, 0x43, 0xE8, 0x99, 0xA9, 0x43, + 0xE8, 0x99, 0xAB, 0x43, 0xE8, 0x9A, 0x88, 0x43, + 0xE8, 0x9A, 0xA9, 0x43, 0xE8, 0x9B, 0xA2, 0x43, + // Bytes 12c0 - 12ff + 0xE8, 0x9C, 0x8E, 0x43, 0xE8, 0x9C, 0xA8, 0x43, + 0xE8, 0x9D, 0xAB, 0x43, 0xE8, 0x9D, 0xB9, 0x43, + 0xE8, 0x9E, 0x86, 0x43, 0xE8, 0x9E, 0xBA, 0x43, + 0xE8, 0x9F, 0xA1, 0x43, 0xE8, 0xA0, 0x81, 0x43, + 0xE8, 0xA0, 0x9F, 0x43, 0xE8, 0xA1, 0x80, 0x43, + 0xE8, 0xA1, 0x8C, 0x43, 0xE8, 0xA1, 0xA0, 0x43, + 0xE8, 0xA1, 0xA3, 0x43, 0xE8, 0xA3, 0x82, 0x43, + 0xE8, 0xA3, 0x8F, 0x43, 0xE8, 0xA3, 0x97, 0x43, + // Bytes 1300 - 133f + 0xE8, 0xA3, 0x9E, 0x43, 0xE8, 0xA3, 0xA1, 0x43, + 0xE8, 0xA3, 0xB8, 0x43, 0xE8, 0xA3, 0xBA, 0x43, + 0xE8, 0xA4, 0x90, 0x43, 0xE8, 0xA5, 0x81, 0x43, + 0xE8, 0xA5, 0xA4, 0x43, 0xE8, 0xA5, 0xBE, 0x43, + 0xE8, 0xA6, 0x86, 0x43, 0xE8, 0xA6, 0x8B, 0x43, + 0xE8, 0xA6, 0x96, 0x43, 0xE8, 0xA7, 0x92, 0x43, + 0xE8, 0xA7, 0xA3, 0x43, 0xE8, 0xA8, 0x80, 0x43, + 0xE8, 0xAA, 0xA0, 0x43, 0xE8, 0xAA, 0xAA, 0x43, + // Bytes 1340 - 137f + 0xE8, 0xAA, 0xBF, 0x43, 0xE8, 0xAB, 0x8B, 0x43, + 0xE8, 0xAB, 0x92, 0x43, 0xE8, 0xAB, 0x96, 0x43, + 0xE8, 0xAB, 0xAD, 0x43, 0xE8, 0xAB, 0xB8, 0x43, + 0xE8, 0xAB, 0xBE, 0x43, 0xE8, 0xAC, 0x81, 0x43, + 0xE8, 0xAC, 0xB9, 0x43, 0xE8, 0xAD, 0x98, 0x43, + 0xE8, 0xAE, 0x80, 0x43, 0xE8, 0xAE, 0x8A, 0x43, + 0xE8, 0xB0, 0xB7, 0x43, 0xE8, 0xB1, 0x86, 0x43, + 0xE8, 0xB1, 0x88, 0x43, 0xE8, 0xB1, 0x95, 0x43, + // Bytes 1380 - 13bf + 0xE8, 0xB1, 0xB8, 0x43, 0xE8, 0xB2, 0x9D, 0x43, + 0xE8, 0xB2, 0xA1, 0x43, 0xE8, 0xB2, 0xA9, 0x43, + 0xE8, 0xB2, 0xAB, 0x43, 0xE8, 0xB3, 0x81, 0x43, + 0xE8, 0xB3, 0x82, 0x43, 0xE8, 0xB3, 0x87, 0x43, + 0xE8, 0xB3, 0x88, 0x43, 0xE8, 0xB3, 0x93, 0x43, + 0xE8, 0xB4, 0x88, 0x43, 0xE8, 0xB4, 0x9B, 0x43, + 0xE8, 0xB5, 0xA4, 0x43, 0xE8, 0xB5, 0xB0, 0x43, + 0xE8, 0xB5, 0xB7, 0x43, 0xE8, 0xB6, 0xB3, 0x43, + // Bytes 13c0 - 13ff + 0xE8, 0xB6, 0xBC, 0x43, 0xE8, 0xB7, 0x8B, 0x43, + 0xE8, 0xB7, 0xAF, 0x43, 0xE8, 0xB7, 0xB0, 0x43, + 0xE8, 0xBA, 0xAB, 0x43, 0xE8, 0xBB, 0x8A, 0x43, + 0xE8, 0xBB, 0x94, 0x43, 0xE8, 0xBC, 0xA6, 0x43, + 0xE8, 0xBC, 0xAA, 0x43, 0xE8, 0xBC, 0xB8, 0x43, + 0xE8, 0xBC, 0xBB, 0x43, 0xE8, 0xBD, 0xA2, 0x43, + 0xE8, 0xBE, 0x9B, 0x43, 0xE8, 0xBE, 0x9E, 0x43, + 0xE8, 0xBE, 0xB0, 0x43, 0xE8, 0xBE, 0xB5, 0x43, + // Bytes 1400 - 143f + 0xE8, 0xBE, 0xB6, 0x43, 0xE9, 0x80, 0xA3, 0x43, + 0xE9, 0x80, 0xB8, 0x43, 0xE9, 0x81, 0x8A, 0x43, + 0xE9, 0x81, 0xA9, 0x43, 0xE9, 0x81, 0xB2, 0x43, + 0xE9, 0x81, 0xBC, 0x43, 0xE9, 0x82, 0x8F, 0x43, + 0xE9, 0x82, 0x91, 0x43, 0xE9, 0x82, 0x94, 0x43, + 0xE9, 0x83, 0x8E, 0x43, 0xE9, 0x83, 0x9E, 0x43, + 0xE9, 0x83, 0xB1, 0x43, 0xE9, 0x83, 0xBD, 0x43, + 0xE9, 0x84, 0x91, 0x43, 0xE9, 0x84, 0x9B, 0x43, + // Bytes 1440 - 147f + 0xE9, 0x85, 0x89, 0x43, 0xE9, 0x85, 0x8D, 0x43, + 0xE9, 0x85, 0xAA, 0x43, 0xE9, 0x86, 0x99, 0x43, + 0xE9, 0x86, 0xB4, 0x43, 0xE9, 0x87, 0x86, 0x43, + 0xE9, 0x87, 0x8C, 0x43, 0xE9, 0x87, 0x8F, 0x43, + 0xE9, 0x87, 0x91, 0x43, 0xE9, 0x88, 0xB4, 0x43, + 0xE9, 0x88, 0xB8, 0x43, 0xE9, 0x89, 0xB6, 0x43, + 0xE9, 0x89, 0xBC, 0x43, 0xE9, 0x8B, 0x97, 0x43, + 0xE9, 0x8B, 0x98, 0x43, 0xE9, 0x8C, 0x84, 0x43, + // Bytes 1480 - 14bf + 0xE9, 0x8D, 0x8A, 0x43, 0xE9, 0x8F, 0xB9, 0x43, + 0xE9, 0x90, 0x95, 0x43, 0xE9, 0x95, 0xB7, 0x43, + 0xE9, 0x96, 0x80, 0x43, 0xE9, 0x96, 0x8B, 0x43, + 0xE9, 0x96, 0xAD, 0x43, 0xE9, 0x96, 0xB7, 0x43, + 0xE9, 0x98, 0x9C, 0x43, 0xE9, 0x98, 0xAE, 0x43, + 0xE9, 0x99, 0x8B, 0x43, 0xE9, 0x99, 0x8D, 0x43, + 0xE9, 0x99, 0xB5, 0x43, 0xE9, 0x99, 0xB8, 0x43, + 0xE9, 0x99, 0xBC, 0x43, 0xE9, 0x9A, 0x86, 0x43, + // Bytes 14c0 - 14ff + 0xE9, 0x9A, 0xA3, 0x43, 0xE9, 0x9A, 0xB6, 0x43, + 0xE9, 0x9A, 0xB7, 0x43, 0xE9, 0x9A, 0xB8, 0x43, + 0xE9, 0x9A, 0xB9, 0x43, 0xE9, 0x9B, 0x83, 0x43, + 0xE9, 0x9B, 0xA2, 0x43, 0xE9, 0x9B, 0xA3, 0x43, + 0xE9, 0x9B, 0xA8, 0x43, 0xE9, 0x9B, 0xB6, 0x43, + 0xE9, 0x9B, 0xB7, 0x43, 0xE9, 0x9C, 0xA3, 0x43, + 0xE9, 0x9C, 0xB2, 0x43, 0xE9, 0x9D, 0x88, 0x43, + 0xE9, 0x9D, 0x91, 0x43, 0xE9, 0x9D, 0x96, 0x43, + // Bytes 1500 - 153f + 0xE9, 0x9D, 0x9E, 0x43, 0xE9, 0x9D, 0xA2, 0x43, + 0xE9, 0x9D, 0xA9, 0x43, 0xE9, 0x9F, 0x8B, 0x43, + 0xE9, 0x9F, 0x9B, 0x43, 0xE9, 0x9F, 0xA0, 0x43, + 0xE9, 0x9F, 0xAD, 0x43, 0xE9, 0x9F, 0xB3, 0x43, + 0xE9, 0x9F, 0xBF, 0x43, 0xE9, 0xA0, 0x81, 0x43, + 0xE9, 0xA0, 0x85, 0x43, 0xE9, 0xA0, 0x8B, 0x43, + 0xE9, 0xA0, 0x98, 0x43, 0xE9, 0xA0, 0xA9, 0x43, + 0xE9, 0xA0, 0xBB, 0x43, 0xE9, 0xA1, 0x9E, 0x43, + // Bytes 1540 - 157f + 0xE9, 0xA2, 0xA8, 0x43, 0xE9, 0xA3, 0x9B, 0x43, + 0xE9, 0xA3, 0x9F, 0x43, 0xE9, 0xA3, 0xA2, 0x43, + 0xE9, 0xA3, 0xAF, 0x43, 0xE9, 0xA3, 0xBC, 0x43, + 0xE9, 0xA4, 0xA8, 0x43, 0xE9, 0xA4, 0xA9, 0x43, + 0xE9, 0xA6, 0x96, 0x43, 0xE9, 0xA6, 0x99, 0x43, + 0xE9, 0xA6, 0xA7, 0x43, 0xE9, 0xA6, 0xAC, 0x43, + 0xE9, 0xA7, 0x82, 0x43, 0xE9, 0xA7, 0xB1, 0x43, + 0xE9, 0xA7, 0xBE, 0x43, 0xE9, 0xA9, 0xAA, 0x43, + // Bytes 1580 - 15bf + 0xE9, 0xAA, 0xA8, 0x43, 0xE9, 0xAB, 0x98, 0x43, + 0xE9, 0xAB, 0x9F, 0x43, 0xE9, 0xAC, 0x92, 0x43, + 0xE9, 0xAC, 0xA5, 0x43, 0xE9, 0xAC, 0xAF, 0x43, + 0xE9, 0xAC, 0xB2, 0x43, 0xE9, 0xAC, 0xBC, 0x43, + 0xE9, 0xAD, 0x9A, 0x43, 0xE9, 0xAD, 0xAF, 0x43, + 0xE9, 0xB1, 0x80, 0x43, 0xE9, 0xB1, 0x97, 0x43, + 0xE9, 0xB3, 0xA5, 0x43, 0xE9, 0xB3, 0xBD, 0x43, + 0xE9, 0xB5, 0xA7, 0x43, 0xE9, 0xB6, 0xB4, 0x43, + // Bytes 15c0 - 15ff + 0xE9, 0xB7, 0xBA, 0x43, 0xE9, 0xB8, 0x9E, 0x43, + 0xE9, 0xB9, 0xB5, 0x43, 0xE9, 0xB9, 0xBF, 0x43, + 0xE9, 0xBA, 0x97, 0x43, 0xE9, 0xBA, 0x9F, 0x43, + 0xE9, 0xBA, 0xA5, 0x43, 0xE9, 0xBA, 0xBB, 0x43, + 0xE9, 0xBB, 0x83, 0x43, 0xE9, 0xBB, 0x8D, 0x43, + 0xE9, 0xBB, 0x8E, 0x43, 0xE9, 0xBB, 0x91, 0x43, + 0xE9, 0xBB, 0xB9, 0x43, 0xE9, 0xBB, 0xBD, 0x43, + 0xE9, 0xBB, 0xBE, 0x43, 0xE9, 0xBC, 0x85, 0x43, + // Bytes 1600 - 163f + 0xE9, 0xBC, 0x8E, 0x43, 0xE9, 0xBC, 0x8F, 0x43, + 0xE9, 0xBC, 0x93, 0x43, 0xE9, 0xBC, 0x96, 0x43, + 0xE9, 0xBC, 0xA0, 0x43, 0xE9, 0xBC, 0xBB, 0x43, + 0xE9, 0xBD, 0x83, 0x43, 0xE9, 0xBD, 0x8A, 0x43, + 0xE9, 0xBD, 0x92, 0x43, 0xE9, 0xBE, 0x8D, 0x43, + 0xE9, 0xBE, 0x8E, 0x43, 0xE9, 0xBE, 0x9C, 0x43, + 0xE9, 0xBE, 0x9F, 0x43, 0xE9, 0xBE, 0xA0, 0x43, + 0xEA, 0x9C, 0xA7, 0x43, 0xEA, 0x9D, 0xAF, 0x43, + // Bytes 1640 - 167f + 0xEA, 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x44, + 0xF0, 0xA0, 0x84, 0xA2, 0x44, 0xF0, 0xA0, 0x94, + 0x9C, 0x44, 0xF0, 0xA0, 0x94, 0xA5, 0x44, 0xF0, + 0xA0, 0x95, 0x8B, 0x44, 0xF0, 0xA0, 0x98, 0xBA, + 0x44, 0xF0, 0xA0, 0xA0, 0x84, 0x44, 0xF0, 0xA0, + 0xA3, 0x9E, 0x44, 0xF0, 0xA0, 0xA8, 0xAC, 0x44, + 0xF0, 0xA0, 0xAD, 0xA3, 0x44, 0xF0, 0xA1, 0x93, + 0xA4, 0x44, 0xF0, 0xA1, 0x9A, 0xA8, 0x44, 0xF0, + // Bytes 1680 - 16bf + 0xA1, 0x9B, 0xAA, 0x44, 0xF0, 0xA1, 0xA7, 0x88, + 0x44, 0xF0, 0xA1, 0xAC, 0x98, 0x44, 0xF0, 0xA1, + 0xB4, 0x8B, 0x44, 0xF0, 0xA1, 0xB7, 0xA4, 0x44, + 0xF0, 0xA1, 0xB7, 0xA6, 0x44, 0xF0, 0xA2, 0x86, + 0x83, 0x44, 0xF0, 0xA2, 0x86, 0x9F, 0x44, 0xF0, + 0xA2, 0x8C, 0xB1, 0x44, 0xF0, 0xA2, 0x9B, 0x94, + 0x44, 0xF0, 0xA2, 0xA1, 0x84, 0x44, 0xF0, 0xA2, + 0xA1, 0x8A, 0x44, 0xF0, 0xA2, 0xAC, 0x8C, 0x44, + // Bytes 16c0 - 16ff + 0xF0, 0xA2, 0xAF, 0xB1, 0x44, 0xF0, 0xA3, 0x80, + 0x8A, 0x44, 0xF0, 0xA3, 0x8A, 0xB8, 0x44, 0xF0, + 0xA3, 0x8D, 0x9F, 0x44, 0xF0, 0xA3, 0x8E, 0x93, + 0x44, 0xF0, 0xA3, 0x8E, 0x9C, 0x44, 0xF0, 0xA3, + 0x8F, 0x83, 0x44, 0xF0, 0xA3, 0x8F, 0x95, 0x44, + 0xF0, 0xA3, 0x91, 0xAD, 0x44, 0xF0, 0xA3, 0x9A, + 0xA3, 0x44, 0xF0, 0xA3, 0xA2, 0xA7, 0x44, 0xF0, + 0xA3, 0xAA, 0x8D, 0x44, 0xF0, 0xA3, 0xAB, 0xBA, + // Bytes 1700 - 173f + 0x44, 0xF0, 0xA3, 0xB2, 0xBC, 0x44, 0xF0, 0xA3, + 0xB4, 0x9E, 0x44, 0xF0, 0xA3, 0xBB, 0x91, 0x44, + 0xF0, 0xA3, 0xBD, 0x9E, 0x44, 0xF0, 0xA3, 0xBE, + 0x8E, 0x44, 0xF0, 0xA4, 0x89, 0xA3, 0x44, 0xF0, + 0xA4, 0x8B, 0xAE, 0x44, 0xF0, 0xA4, 0x8E, 0xAB, + 0x44, 0xF0, 0xA4, 0x98, 0x88, 0x44, 0xF0, 0xA4, + 0x9C, 0xB5, 0x44, 0xF0, 0xA4, 0xA0, 0x94, 0x44, + 0xF0, 0xA4, 0xB0, 0xB6, 0x44, 0xF0, 0xA4, 0xB2, + // Bytes 1740 - 177f + 0x92, 0x44, 0xF0, 0xA4, 0xBE, 0xA1, 0x44, 0xF0, + 0xA4, 0xBE, 0xB8, 0x44, 0xF0, 0xA5, 0x81, 0x84, + 0x44, 0xF0, 0xA5, 0x83, 0xB2, 0x44, 0xF0, 0xA5, + 0x83, 0xB3, 0x44, 0xF0, 0xA5, 0x84, 0x99, 0x44, + 0xF0, 0xA5, 0x84, 0xB3, 0x44, 0xF0, 0xA5, 0x89, + 0x89, 0x44, 0xF0, 0xA5, 0x90, 0x9D, 0x44, 0xF0, + 0xA5, 0x98, 0xA6, 0x44, 0xF0, 0xA5, 0x9A, 0x9A, + 0x44, 0xF0, 0xA5, 0x9B, 0x85, 0x44, 0xF0, 0xA5, + // Bytes 1780 - 17bf + 0xA5, 0xBC, 0x44, 0xF0, 0xA5, 0xAA, 0xA7, 0x44, + 0xF0, 0xA5, 0xAE, 0xAB, 0x44, 0xF0, 0xA5, 0xB2, + 0x80, 0x44, 0xF0, 0xA5, 0xB3, 0x90, 0x44, 0xF0, + 0xA5, 0xBE, 0x86, 0x44, 0xF0, 0xA6, 0x87, 0x9A, + 0x44, 0xF0, 0xA6, 0x88, 0xA8, 0x44, 0xF0, 0xA6, + 0x89, 0x87, 0x44, 0xF0, 0xA6, 0x8B, 0x99, 0x44, + 0xF0, 0xA6, 0x8C, 0xBE, 0x44, 0xF0, 0xA6, 0x93, + 0x9A, 0x44, 0xF0, 0xA6, 0x94, 0xA3, 0x44, 0xF0, + // Bytes 17c0 - 17ff + 0xA6, 0x96, 0xA8, 0x44, 0xF0, 0xA6, 0x9E, 0xA7, + 0x44, 0xF0, 0xA6, 0x9E, 0xB5, 0x44, 0xF0, 0xA6, + 0xAC, 0xBC, 0x44, 0xF0, 0xA6, 0xB0, 0xB6, 0x44, + 0xF0, 0xA6, 0xB3, 0x95, 0x44, 0xF0, 0xA6, 0xB5, + 0xAB, 0x44, 0xF0, 0xA6, 0xBC, 0xAC, 0x44, 0xF0, + 0xA6, 0xBE, 0xB1, 0x44, 0xF0, 0xA7, 0x83, 0x92, + 0x44, 0xF0, 0xA7, 0x8F, 0x8A, 0x44, 0xF0, 0xA7, + 0x99, 0xA7, 0x44, 0xF0, 0xA7, 0xA2, 0xAE, 0x44, + // Bytes 1800 - 183f + 0xF0, 0xA7, 0xA5, 0xA6, 0x44, 0xF0, 0xA7, 0xB2, + 0xA8, 0x44, 0xF0, 0xA7, 0xBB, 0x93, 0x44, 0xF0, + 0xA7, 0xBC, 0xAF, 0x44, 0xF0, 0xA8, 0x97, 0x92, + 0x44, 0xF0, 0xA8, 0x97, 0xAD, 0x44, 0xF0, 0xA8, + 0x9C, 0xAE, 0x44, 0xF0, 0xA8, 0xAF, 0xBA, 0x44, + 0xF0, 0xA8, 0xB5, 0xB7, 0x44, 0xF0, 0xA9, 0x85, + 0x85, 0x44, 0xF0, 0xA9, 0x87, 0x9F, 0x44, 0xF0, + 0xA9, 0x88, 0x9A, 0x44, 0xF0, 0xA9, 0x90, 0x8A, + // Bytes 1840 - 187f + 0x44, 0xF0, 0xA9, 0x92, 0x96, 0x44, 0xF0, 0xA9, + 0x96, 0xB6, 0x44, 0xF0, 0xA9, 0xAC, 0xB0, 0x44, + 0xF0, 0xAA, 0x83, 0x8E, 0x44, 0xF0, 0xAA, 0x84, + 0x85, 0x44, 0xF0, 0xAA, 0x88, 0x8E, 0x44, 0xF0, + 0xAA, 0x8A, 0x91, 0x44, 0xF0, 0xAA, 0x8E, 0x92, + 0x44, 0xF0, 0xAA, 0x98, 0x80, 0x42, 0x21, 0x21, + 0x42, 0x21, 0x3F, 0x42, 0x2E, 0x2E, 0x42, 0x30, + 0x2C, 0x42, 0x30, 0x2E, 0x42, 0x31, 0x2C, 0x42, + // Bytes 1880 - 18bf + 0x31, 0x2E, 0x42, 0x31, 0x30, 0x42, 0x31, 0x31, + 0x42, 0x31, 0x32, 0x42, 0x31, 0x33, 0x42, 0x31, + 0x34, 0x42, 0x31, 0x35, 0x42, 0x31, 0x36, 0x42, + 0x31, 0x37, 0x42, 0x31, 0x38, 0x42, 0x31, 0x39, + 0x42, 0x32, 0x2C, 0x42, 0x32, 0x2E, 0x42, 0x32, + 0x30, 0x42, 0x32, 0x31, 0x42, 0x32, 0x32, 0x42, + 0x32, 0x33, 0x42, 0x32, 0x34, 0x42, 0x32, 0x35, + 0x42, 0x32, 0x36, 0x42, 0x32, 0x37, 0x42, 0x32, + // Bytes 18c0 - 18ff + 0x38, 0x42, 0x32, 0x39, 0x42, 0x33, 0x2C, 0x42, + 0x33, 0x2E, 0x42, 0x33, 0x30, 0x42, 0x33, 0x31, + 0x42, 0x33, 0x32, 0x42, 0x33, 0x33, 0x42, 0x33, + 0x34, 0x42, 0x33, 0x35, 0x42, 0x33, 0x36, 0x42, + 0x33, 0x37, 0x42, 0x33, 0x38, 0x42, 0x33, 0x39, + 0x42, 0x34, 0x2C, 0x42, 0x34, 0x2E, 0x42, 0x34, + 0x30, 0x42, 0x34, 0x31, 0x42, 0x34, 0x32, 0x42, + 0x34, 0x33, 0x42, 0x34, 0x34, 0x42, 0x34, 0x35, + // Bytes 1900 - 193f + 0x42, 0x34, 0x36, 0x42, 0x34, 0x37, 0x42, 0x34, + 0x38, 0x42, 0x34, 0x39, 0x42, 0x35, 0x2C, 0x42, + 0x35, 0x2E, 0x42, 0x35, 0x30, 0x42, 0x36, 0x2C, + 0x42, 0x36, 0x2E, 0x42, 0x37, 0x2C, 0x42, 0x37, + 0x2E, 0x42, 0x38, 0x2C, 0x42, 0x38, 0x2E, 0x42, + 0x39, 0x2C, 0x42, 0x39, 0x2E, 0x42, 0x3D, 0x3D, + 0x42, 0x3F, 0x21, 0x42, 0x3F, 0x3F, 0x42, 0x41, + 0x55, 0x42, 0x42, 0x71, 0x42, 0x43, 0x44, 0x42, + // Bytes 1940 - 197f + 0x44, 0x4A, 0x42, 0x44, 0x5A, 0x42, 0x44, 0x7A, + 0x42, 0x47, 0x42, 0x42, 0x47, 0x79, 0x42, 0x48, + 0x50, 0x42, 0x48, 0x56, 0x42, 0x48, 0x67, 0x42, + 0x48, 0x7A, 0x42, 0x49, 0x49, 0x42, 0x49, 0x4A, + 0x42, 0x49, 0x55, 0x42, 0x49, 0x56, 0x42, 0x49, + 0x58, 0x42, 0x4B, 0x42, 0x42, 0x4B, 0x4B, 0x42, + 0x4B, 0x4D, 0x42, 0x4C, 0x4A, 0x42, 0x4C, 0x6A, + 0x42, 0x4D, 0x42, 0x42, 0x4D, 0x43, 0x42, 0x4D, + // Bytes 1980 - 19bf + 0x44, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + // Bytes 19c0 - 19ff + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + // Bytes 1a00 - 1a3f + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + // Bytes 1a40 - 1a7f + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + // Bytes 1a80 - 1abf + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + // Bytes 1ac0 - 1aff + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + // Bytes 1b00 - 1b3f + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + // Bytes 1b40 - 1b7f + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + // Bytes 1b80 - 1bbf + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + // Bytes 1bc0 - 1bff + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + // Bytes 1c00 - 1c3f + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + // Bytes 1c40 - 1c7f + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + // Bytes 1c80 - 1cbf + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + // Bytes 1cc0 - 1cff + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + // Bytes 1d00 - 1d3f + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + // Bytes 1d40 - 1d7f + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + // Bytes 1d80 - 1dbf + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + // Bytes 1dc0 - 1dff + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + // Bytes 1e00 - 1e3f + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + // Bytes 1e40 - 1e7f + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + // Bytes 1e80 - 1ebf + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + // Bytes 1ec0 - 1eff + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + // Bytes 1f00 - 1f3f + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + // Bytes 1f40 - 1f7f + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + // Bytes 1f80 - 1fbf + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + // Bytes 1fc0 - 1fff + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + // Bytes 2000 - 203f + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + // Bytes 2040 - 207f + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + // Bytes 2080 - 20bf + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + // Bytes 20c0 - 20ff + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + // Bytes 2100 - 213f + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + // Bytes 2140 - 217f + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + // Bytes 2180 - 21bf + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + // Bytes 21c0 - 21ff + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2200 - 223f + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + // Bytes 2240 - 227f + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + // Bytes 2280 - 22bf + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + // Bytes 22c0 - 22ff + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + // Bytes 2300 - 233f + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + // Bytes 2340 - 237f + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + // Bytes 2380 - 23bf + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + // Bytes 23c0 - 23ff + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + // Bytes 2400 - 243f + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + // Bytes 2440 - 247f + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + // Bytes 2480 - 24bf + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + // Bytes 24c0 - 24ff + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2500 - 253f + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + // Bytes 2540 - 257f + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + // Bytes 2580 - 25bf + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + // Bytes 25c0 - 25ff + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + // Bytes 2600 - 263f + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + // Bytes 2640 - 267f + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + // Bytes 2680 - 26bf + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + // Bytes 26c0 - 26ff + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, + // Bytes 2700 - 273f + 0xA3, 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, + 0x46, 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, + 0xE6, 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, + 0x61, 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, + 0x80, 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, + 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + // Bytes 2740 - 277f + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x89, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, + // Bytes 2780 - 27bf + 0x48, 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x92, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, + 0xA7, 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, + // Bytes 27c0 - 27ff + 0xD8, 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, + 0x48, 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, + 0x84, 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, + 0xD9, 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, + 0xB9, 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, + 0xAD, 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, + 0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, + // Bytes 2800 - 283f + 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x49, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, + 0x80, 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, + 0xE2, 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, + 0x80, 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, + 0x49, 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, + 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, + // Bytes 2840 - 287f + 0x9D, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, + 0xE5, 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, + 0x80, 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, + 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, + 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, + 0xAC, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, + 0xE7, 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, + 0x80, 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, + // Bytes 2880 - 28bf + 0x49, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, + 0xE3, 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, + 0x82, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, + 0x49, 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, + // Bytes 28c0 - 28ff + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, + 0x82, 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, + 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, + 0xE3, 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, + 0x49, 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, + // Bytes 2900 - 293f + 0x83, 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, + 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, + 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, + 0x49, 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x9A, 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, + // Bytes 2940 - 297f + 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x49, 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, + 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, + 0x83, 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, + 0x49, 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, + // Bytes 2980 - 29bf + 0xA2, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, + 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, + 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0xE2, 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, + 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0x4C, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, + 0xA8, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, + // Bytes 29c0 - 29ff + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, + 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, + 0xE3, 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, + 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, + 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, + // Bytes 2a00 - 2a3f + 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, + 0x4C, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, + 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, + 0xA4, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, + 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + // Bytes 2a40 - 2a7f + 0xBC, 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x84, 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x83, 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, + 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, + // Bytes 2a80 - 2abf + 0x83, 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, + 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, + 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, + 0xAF, 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, + 0xB3, 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + // Bytes 2ac0 - 2aff + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0x4C, 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, + 0xBC, 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, + 0x84, 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, + // Bytes 2b00 - 2b3f + 0x84, 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, + 0xD9, 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x9A, 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, + 0x83, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, + // Bytes 2b40 - 2b7f + 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, + 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, + // Bytes 2b80 - 2bbf + 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, + 0xA7, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, + 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0x88, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, + 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, + 0x85, 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, + // Bytes 2bc0 - 2bff + 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xBC, 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xA9, 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, + 0xAB, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, + 0x82, 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, + 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, + 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, + 0x52, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, + // Bytes 2c40 - 2c7f + 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, + 0xE3, 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x83, 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, + // Bytes 2c80 - 2cbf + 0x84, 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, + 0xD9, 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, + 0x84, 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, + 0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, + 0xA7, 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, + 0xA7, 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, + 0xAD, 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, + 0xAD, 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, + // Bytes 2cc0 - 2cff + 0xAD, 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, + 0xAE, 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, + 0xAF, 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, + 0xAF, 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, + 0xAF, 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, + 0xB2, 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, + 0xB3, 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, + 0xB3, 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, + // Bytes 2d00 - 2d3f + 0xB5, 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, + 0xB5, 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, + 0xB5, 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, + 0xB7, 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, + 0x80, 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, + 0xAC, 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + // Bytes 2d40 - 2d7f + 0xAC, 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAD, 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, + // Bytes 2d80 - 2dbf + 0x91, 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, + 0x08, 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, + 0xA7, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, + 0x91, 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, + 0x87, 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, + 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, + 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, + 0xBA, 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, + // Bytes 2dc0 - 2dff + 0x91, 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, + 0xB8, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, + 0x91, 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, + 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0xE0, + 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, 0xE0, + 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x12, 0x44, 0x44, + 0x5A, 0xCC, 0x8C, 0xC9, 0x44, 0x44, 0x7A, 0xCC, + 0x8C, 0xC9, 0x44, 0x64, 0x7A, 0xCC, 0x8C, 0xC9, + // Bytes 2e00 - 2e3f + 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, 0xC9, + 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, 0xC9, + 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, + 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, 0x01, + // Bytes 2e40 - 2e7f + 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, 0x01, + 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, 0x01, + // Bytes 2e80 - 2ebf + 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, 0x01, + 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, 0xE3, + 0x82, 0x99, 0x0D, 0x4C, 0xE1, 0x84, 0x8C, 0xE1, + 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xB4, + 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D, 0x4C, + 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 2ec0 - 2eff + 0x9B, 0xE3, 0x82, 0x9A, 0x0D, 0x4C, 0xE3, 0x83, + 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3, + 0x82, 0x99, 0x0D, 0x4F, 0xE1, 0x84, 0x8E, 0xE1, + 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, 0x80, + 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3, 0x82, + 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, + // Bytes 2f00 - 2f3f + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3, + 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D, 0x4F, + 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D, + 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x0D, 0x52, 0xE3, 0x83, 0x95, + // Bytes 2f40 - 2f7f + 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D, + 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0x01, + 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, 0x01, + 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, 0xCC, + 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, 0x03, + 0x41, 0xCC, 0x80, 0xC9, 0x03, 0x41, 0xCC, 0x81, + 0xC9, 0x03, 0x41, 0xCC, 0x83, 0xC9, 0x03, 0x41, + // Bytes 2f80 - 2fbf + 0xCC, 0x84, 0xC9, 0x03, 0x41, 0xCC, 0x89, 0xC9, + 0x03, 0x41, 0xCC, 0x8C, 0xC9, 0x03, 0x41, 0xCC, + 0x8F, 0xC9, 0x03, 0x41, 0xCC, 0x91, 0xC9, 0x03, + 0x41, 0xCC, 0xA5, 0xB5, 0x03, 0x41, 0xCC, 0xA8, + 0xA5, 0x03, 0x42, 0xCC, 0x87, 0xC9, 0x03, 0x42, + 0xCC, 0xA3, 0xB5, 0x03, 0x42, 0xCC, 0xB1, 0xB5, + 0x03, 0x43, 0xCC, 0x81, 0xC9, 0x03, 0x43, 0xCC, + 0x82, 0xC9, 0x03, 0x43, 0xCC, 0x87, 0xC9, 0x03, + // Bytes 2fc0 - 2fff + 0x43, 0xCC, 0x8C, 0xC9, 0x03, 0x44, 0xCC, 0x87, + 0xC9, 0x03, 0x44, 0xCC, 0x8C, 0xC9, 0x03, 0x44, + 0xCC, 0xA3, 0xB5, 0x03, 0x44, 0xCC, 0xA7, 0xA5, + 0x03, 0x44, 0xCC, 0xAD, 0xB5, 0x03, 0x44, 0xCC, + 0xB1, 0xB5, 0x03, 0x45, 0xCC, 0x80, 0xC9, 0x03, + 0x45, 0xCC, 0x81, 0xC9, 0x03, 0x45, 0xCC, 0x83, + 0xC9, 0x03, 0x45, 0xCC, 0x86, 0xC9, 0x03, 0x45, + 0xCC, 0x87, 0xC9, 0x03, 0x45, 0xCC, 0x88, 0xC9, + // Bytes 3000 - 303f + 0x03, 0x45, 0xCC, 0x89, 0xC9, 0x03, 0x45, 0xCC, + 0x8C, 0xC9, 0x03, 0x45, 0xCC, 0x8F, 0xC9, 0x03, + 0x45, 0xCC, 0x91, 0xC9, 0x03, 0x45, 0xCC, 0xA8, + 0xA5, 0x03, 0x45, 0xCC, 0xAD, 0xB5, 0x03, 0x45, + 0xCC, 0xB0, 0xB5, 0x03, 0x46, 0xCC, 0x87, 0xC9, + 0x03, 0x47, 0xCC, 0x81, 0xC9, 0x03, 0x47, 0xCC, + 0x82, 0xC9, 0x03, 0x47, 0xCC, 0x84, 0xC9, 0x03, + 0x47, 0xCC, 0x86, 0xC9, 0x03, 0x47, 0xCC, 0x87, + // Bytes 3040 - 307f + 0xC9, 0x03, 0x47, 0xCC, 0x8C, 0xC9, 0x03, 0x47, + 0xCC, 0xA7, 0xA5, 0x03, 0x48, 0xCC, 0x82, 0xC9, + 0x03, 0x48, 0xCC, 0x87, 0xC9, 0x03, 0x48, 0xCC, + 0x88, 0xC9, 0x03, 0x48, 0xCC, 0x8C, 0xC9, 0x03, + 0x48, 0xCC, 0xA3, 0xB5, 0x03, 0x48, 0xCC, 0xA7, + 0xA5, 0x03, 0x48, 0xCC, 0xAE, 0xB5, 0x03, 0x49, + 0xCC, 0x80, 0xC9, 0x03, 0x49, 0xCC, 0x81, 0xC9, + 0x03, 0x49, 0xCC, 0x82, 0xC9, 0x03, 0x49, 0xCC, + // Bytes 3080 - 30bf + 0x83, 0xC9, 0x03, 0x49, 0xCC, 0x84, 0xC9, 0x03, + 0x49, 0xCC, 0x86, 0xC9, 0x03, 0x49, 0xCC, 0x87, + 0xC9, 0x03, 0x49, 0xCC, 0x89, 0xC9, 0x03, 0x49, + 0xCC, 0x8C, 0xC9, 0x03, 0x49, 0xCC, 0x8F, 0xC9, + 0x03, 0x49, 0xCC, 0x91, 0xC9, 0x03, 0x49, 0xCC, + 0xA3, 0xB5, 0x03, 0x49, 0xCC, 0xA8, 0xA5, 0x03, + 0x49, 0xCC, 0xB0, 0xB5, 0x03, 0x4A, 0xCC, 0x82, + 0xC9, 0x03, 0x4B, 0xCC, 0x81, 0xC9, 0x03, 0x4B, + // Bytes 30c0 - 30ff + 0xCC, 0x8C, 0xC9, 0x03, 0x4B, 0xCC, 0xA3, 0xB5, + 0x03, 0x4B, 0xCC, 0xA7, 0xA5, 0x03, 0x4B, 0xCC, + 0xB1, 0xB5, 0x03, 0x4C, 0xCC, 0x81, 0xC9, 0x03, + 0x4C, 0xCC, 0x8C, 0xC9, 0x03, 0x4C, 0xCC, 0xA7, + 0xA5, 0x03, 0x4C, 0xCC, 0xAD, 0xB5, 0x03, 0x4C, + 0xCC, 0xB1, 0xB5, 0x03, 0x4D, 0xCC, 0x81, 0xC9, + 0x03, 0x4D, 0xCC, 0x87, 0xC9, 0x03, 0x4D, 0xCC, + 0xA3, 0xB5, 0x03, 0x4E, 0xCC, 0x80, 0xC9, 0x03, + // Bytes 3100 - 313f + 0x4E, 0xCC, 0x81, 0xC9, 0x03, 0x4E, 0xCC, 0x83, + 0xC9, 0x03, 0x4E, 0xCC, 0x87, 0xC9, 0x03, 0x4E, + 0xCC, 0x8C, 0xC9, 0x03, 0x4E, 0xCC, 0xA3, 0xB5, + 0x03, 0x4E, 0xCC, 0xA7, 0xA5, 0x03, 0x4E, 0xCC, + 0xAD, 0xB5, 0x03, 0x4E, 0xCC, 0xB1, 0xB5, 0x03, + 0x4F, 0xCC, 0x80, 0xC9, 0x03, 0x4F, 0xCC, 0x81, + 0xC9, 0x03, 0x4F, 0xCC, 0x86, 0xC9, 0x03, 0x4F, + 0xCC, 0x89, 0xC9, 0x03, 0x4F, 0xCC, 0x8B, 0xC9, + // Bytes 3140 - 317f + 0x03, 0x4F, 0xCC, 0x8C, 0xC9, 0x03, 0x4F, 0xCC, + 0x8F, 0xC9, 0x03, 0x4F, 0xCC, 0x91, 0xC9, 0x03, + 0x50, 0xCC, 0x81, 0xC9, 0x03, 0x50, 0xCC, 0x87, + 0xC9, 0x03, 0x52, 0xCC, 0x81, 0xC9, 0x03, 0x52, + 0xCC, 0x87, 0xC9, 0x03, 0x52, 0xCC, 0x8C, 0xC9, + 0x03, 0x52, 0xCC, 0x8F, 0xC9, 0x03, 0x52, 0xCC, + 0x91, 0xC9, 0x03, 0x52, 0xCC, 0xA7, 0xA5, 0x03, + 0x52, 0xCC, 0xB1, 0xB5, 0x03, 0x53, 0xCC, 0x82, + // Bytes 3180 - 31bf + 0xC9, 0x03, 0x53, 0xCC, 0x87, 0xC9, 0x03, 0x53, + 0xCC, 0xA6, 0xB5, 0x03, 0x53, 0xCC, 0xA7, 0xA5, + 0x03, 0x54, 0xCC, 0x87, 0xC9, 0x03, 0x54, 0xCC, + 0x8C, 0xC9, 0x03, 0x54, 0xCC, 0xA3, 0xB5, 0x03, + 0x54, 0xCC, 0xA6, 0xB5, 0x03, 0x54, 0xCC, 0xA7, + 0xA5, 0x03, 0x54, 0xCC, 0xAD, 0xB5, 0x03, 0x54, + 0xCC, 0xB1, 0xB5, 0x03, 0x55, 0xCC, 0x80, 0xC9, + 0x03, 0x55, 0xCC, 0x81, 0xC9, 0x03, 0x55, 0xCC, + // Bytes 31c0 - 31ff + 0x82, 0xC9, 0x03, 0x55, 0xCC, 0x86, 0xC9, 0x03, + 0x55, 0xCC, 0x89, 0xC9, 0x03, 0x55, 0xCC, 0x8A, + 0xC9, 0x03, 0x55, 0xCC, 0x8B, 0xC9, 0x03, 0x55, + 0xCC, 0x8C, 0xC9, 0x03, 0x55, 0xCC, 0x8F, 0xC9, + 0x03, 0x55, 0xCC, 0x91, 0xC9, 0x03, 0x55, 0xCC, + 0xA3, 0xB5, 0x03, 0x55, 0xCC, 0xA4, 0xB5, 0x03, + 0x55, 0xCC, 0xA8, 0xA5, 0x03, 0x55, 0xCC, 0xAD, + 0xB5, 0x03, 0x55, 0xCC, 0xB0, 0xB5, 0x03, 0x56, + // Bytes 3200 - 323f + 0xCC, 0x83, 0xC9, 0x03, 0x56, 0xCC, 0xA3, 0xB5, + 0x03, 0x57, 0xCC, 0x80, 0xC9, 0x03, 0x57, 0xCC, + 0x81, 0xC9, 0x03, 0x57, 0xCC, 0x82, 0xC9, 0x03, + 0x57, 0xCC, 0x87, 0xC9, 0x03, 0x57, 0xCC, 0x88, + 0xC9, 0x03, 0x57, 0xCC, 0xA3, 0xB5, 0x03, 0x58, + 0xCC, 0x87, 0xC9, 0x03, 0x58, 0xCC, 0x88, 0xC9, + 0x03, 0x59, 0xCC, 0x80, 0xC9, 0x03, 0x59, 0xCC, + 0x81, 0xC9, 0x03, 0x59, 0xCC, 0x82, 0xC9, 0x03, + // Bytes 3240 - 327f + 0x59, 0xCC, 0x83, 0xC9, 0x03, 0x59, 0xCC, 0x84, + 0xC9, 0x03, 0x59, 0xCC, 0x87, 0xC9, 0x03, 0x59, + 0xCC, 0x88, 0xC9, 0x03, 0x59, 0xCC, 0x89, 0xC9, + 0x03, 0x59, 0xCC, 0xA3, 0xB5, 0x03, 0x5A, 0xCC, + 0x81, 0xC9, 0x03, 0x5A, 0xCC, 0x82, 0xC9, 0x03, + 0x5A, 0xCC, 0x87, 0xC9, 0x03, 0x5A, 0xCC, 0x8C, + 0xC9, 0x03, 0x5A, 0xCC, 0xA3, 0xB5, 0x03, 0x5A, + 0xCC, 0xB1, 0xB5, 0x03, 0x61, 0xCC, 0x80, 0xC9, + // Bytes 3280 - 32bf + 0x03, 0x61, 0xCC, 0x81, 0xC9, 0x03, 0x61, 0xCC, + 0x83, 0xC9, 0x03, 0x61, 0xCC, 0x84, 0xC9, 0x03, + 0x61, 0xCC, 0x89, 0xC9, 0x03, 0x61, 0xCC, 0x8C, + 0xC9, 0x03, 0x61, 0xCC, 0x8F, 0xC9, 0x03, 0x61, + 0xCC, 0x91, 0xC9, 0x03, 0x61, 0xCC, 0xA5, 0xB5, + 0x03, 0x61, 0xCC, 0xA8, 0xA5, 0x03, 0x62, 0xCC, + 0x87, 0xC9, 0x03, 0x62, 0xCC, 0xA3, 0xB5, 0x03, + 0x62, 0xCC, 0xB1, 0xB5, 0x03, 0x63, 0xCC, 0x81, + // Bytes 32c0 - 32ff + 0xC9, 0x03, 0x63, 0xCC, 0x82, 0xC9, 0x03, 0x63, + 0xCC, 0x87, 0xC9, 0x03, 0x63, 0xCC, 0x8C, 0xC9, + 0x03, 0x64, 0xCC, 0x87, 0xC9, 0x03, 0x64, 0xCC, + 0x8C, 0xC9, 0x03, 0x64, 0xCC, 0xA3, 0xB5, 0x03, + 0x64, 0xCC, 0xA7, 0xA5, 0x03, 0x64, 0xCC, 0xAD, + 0xB5, 0x03, 0x64, 0xCC, 0xB1, 0xB5, 0x03, 0x65, + 0xCC, 0x80, 0xC9, 0x03, 0x65, 0xCC, 0x81, 0xC9, + 0x03, 0x65, 0xCC, 0x83, 0xC9, 0x03, 0x65, 0xCC, + // Bytes 3300 - 333f + 0x86, 0xC9, 0x03, 0x65, 0xCC, 0x87, 0xC9, 0x03, + 0x65, 0xCC, 0x88, 0xC9, 0x03, 0x65, 0xCC, 0x89, + 0xC9, 0x03, 0x65, 0xCC, 0x8C, 0xC9, 0x03, 0x65, + 0xCC, 0x8F, 0xC9, 0x03, 0x65, 0xCC, 0x91, 0xC9, + 0x03, 0x65, 0xCC, 0xA8, 0xA5, 0x03, 0x65, 0xCC, + 0xAD, 0xB5, 0x03, 0x65, 0xCC, 0xB0, 0xB5, 0x03, + 0x66, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC, 0x81, + 0xC9, 0x03, 0x67, 0xCC, 0x82, 0xC9, 0x03, 0x67, + // Bytes 3340 - 337f + 0xCC, 0x84, 0xC9, 0x03, 0x67, 0xCC, 0x86, 0xC9, + 0x03, 0x67, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC, + 0x8C, 0xC9, 0x03, 0x67, 0xCC, 0xA7, 0xA5, 0x03, + 0x68, 0xCC, 0x82, 0xC9, 0x03, 0x68, 0xCC, 0x87, + 0xC9, 0x03, 0x68, 0xCC, 0x88, 0xC9, 0x03, 0x68, + 0xCC, 0x8C, 0xC9, 0x03, 0x68, 0xCC, 0xA3, 0xB5, + 0x03, 0x68, 0xCC, 0xA7, 0xA5, 0x03, 0x68, 0xCC, + 0xAE, 0xB5, 0x03, 0x68, 0xCC, 0xB1, 0xB5, 0x03, + // Bytes 3380 - 33bf + 0x69, 0xCC, 0x80, 0xC9, 0x03, 0x69, 0xCC, 0x81, + 0xC9, 0x03, 0x69, 0xCC, 0x82, 0xC9, 0x03, 0x69, + 0xCC, 0x83, 0xC9, 0x03, 0x69, 0xCC, 0x84, 0xC9, + 0x03, 0x69, 0xCC, 0x86, 0xC9, 0x03, 0x69, 0xCC, + 0x89, 0xC9, 0x03, 0x69, 0xCC, 0x8C, 0xC9, 0x03, + 0x69, 0xCC, 0x8F, 0xC9, 0x03, 0x69, 0xCC, 0x91, + 0xC9, 0x03, 0x69, 0xCC, 0xA3, 0xB5, 0x03, 0x69, + 0xCC, 0xA8, 0xA5, 0x03, 0x69, 0xCC, 0xB0, 0xB5, + // Bytes 33c0 - 33ff + 0x03, 0x6A, 0xCC, 0x82, 0xC9, 0x03, 0x6A, 0xCC, + 0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0x81, 0xC9, 0x03, + 0x6B, 0xCC, 0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0xA3, + 0xB5, 0x03, 0x6B, 0xCC, 0xA7, 0xA5, 0x03, 0x6B, + 0xCC, 0xB1, 0xB5, 0x03, 0x6C, 0xCC, 0x81, 0xC9, + 0x03, 0x6C, 0xCC, 0x8C, 0xC9, 0x03, 0x6C, 0xCC, + 0xA7, 0xA5, 0x03, 0x6C, 0xCC, 0xAD, 0xB5, 0x03, + 0x6C, 0xCC, 0xB1, 0xB5, 0x03, 0x6D, 0xCC, 0x81, + // Bytes 3400 - 343f + 0xC9, 0x03, 0x6D, 0xCC, 0x87, 0xC9, 0x03, 0x6D, + 0xCC, 0xA3, 0xB5, 0x03, 0x6E, 0xCC, 0x80, 0xC9, + 0x03, 0x6E, 0xCC, 0x81, 0xC9, 0x03, 0x6E, 0xCC, + 0x83, 0xC9, 0x03, 0x6E, 0xCC, 0x87, 0xC9, 0x03, + 0x6E, 0xCC, 0x8C, 0xC9, 0x03, 0x6E, 0xCC, 0xA3, + 0xB5, 0x03, 0x6E, 0xCC, 0xA7, 0xA5, 0x03, 0x6E, + 0xCC, 0xAD, 0xB5, 0x03, 0x6E, 0xCC, 0xB1, 0xB5, + 0x03, 0x6F, 0xCC, 0x80, 0xC9, 0x03, 0x6F, 0xCC, + // Bytes 3440 - 347f + 0x81, 0xC9, 0x03, 0x6F, 0xCC, 0x86, 0xC9, 0x03, + 0x6F, 0xCC, 0x89, 0xC9, 0x03, 0x6F, 0xCC, 0x8B, + 0xC9, 0x03, 0x6F, 0xCC, 0x8C, 0xC9, 0x03, 0x6F, + 0xCC, 0x8F, 0xC9, 0x03, 0x6F, 0xCC, 0x91, 0xC9, + 0x03, 0x70, 0xCC, 0x81, 0xC9, 0x03, 0x70, 0xCC, + 0x87, 0xC9, 0x03, 0x72, 0xCC, 0x81, 0xC9, 0x03, + 0x72, 0xCC, 0x87, 0xC9, 0x03, 0x72, 0xCC, 0x8C, + 0xC9, 0x03, 0x72, 0xCC, 0x8F, 0xC9, 0x03, 0x72, + // Bytes 3480 - 34bf + 0xCC, 0x91, 0xC9, 0x03, 0x72, 0xCC, 0xA7, 0xA5, + 0x03, 0x72, 0xCC, 0xB1, 0xB5, 0x03, 0x73, 0xCC, + 0x82, 0xC9, 0x03, 0x73, 0xCC, 0x87, 0xC9, 0x03, + 0x73, 0xCC, 0xA6, 0xB5, 0x03, 0x73, 0xCC, 0xA7, + 0xA5, 0x03, 0x74, 0xCC, 0x87, 0xC9, 0x03, 0x74, + 0xCC, 0x88, 0xC9, 0x03, 0x74, 0xCC, 0x8C, 0xC9, + 0x03, 0x74, 0xCC, 0xA3, 0xB5, 0x03, 0x74, 0xCC, + 0xA6, 0xB5, 0x03, 0x74, 0xCC, 0xA7, 0xA5, 0x03, + // Bytes 34c0 - 34ff + 0x74, 0xCC, 0xAD, 0xB5, 0x03, 0x74, 0xCC, 0xB1, + 0xB5, 0x03, 0x75, 0xCC, 0x80, 0xC9, 0x03, 0x75, + 0xCC, 0x81, 0xC9, 0x03, 0x75, 0xCC, 0x82, 0xC9, + 0x03, 0x75, 0xCC, 0x86, 0xC9, 0x03, 0x75, 0xCC, + 0x89, 0xC9, 0x03, 0x75, 0xCC, 0x8A, 0xC9, 0x03, + 0x75, 0xCC, 0x8B, 0xC9, 0x03, 0x75, 0xCC, 0x8C, + 0xC9, 0x03, 0x75, 0xCC, 0x8F, 0xC9, 0x03, 0x75, + 0xCC, 0x91, 0xC9, 0x03, 0x75, 0xCC, 0xA3, 0xB5, + // Bytes 3500 - 353f + 0x03, 0x75, 0xCC, 0xA4, 0xB5, 0x03, 0x75, 0xCC, + 0xA8, 0xA5, 0x03, 0x75, 0xCC, 0xAD, 0xB5, 0x03, + 0x75, 0xCC, 0xB0, 0xB5, 0x03, 0x76, 0xCC, 0x83, + 0xC9, 0x03, 0x76, 0xCC, 0xA3, 0xB5, 0x03, 0x77, + 0xCC, 0x80, 0xC9, 0x03, 0x77, 0xCC, 0x81, 0xC9, + 0x03, 0x77, 0xCC, 0x82, 0xC9, 0x03, 0x77, 0xCC, + 0x87, 0xC9, 0x03, 0x77, 0xCC, 0x88, 0xC9, 0x03, + 0x77, 0xCC, 0x8A, 0xC9, 0x03, 0x77, 0xCC, 0xA3, + // Bytes 3540 - 357f + 0xB5, 0x03, 0x78, 0xCC, 0x87, 0xC9, 0x03, 0x78, + 0xCC, 0x88, 0xC9, 0x03, 0x79, 0xCC, 0x80, 0xC9, + 0x03, 0x79, 0xCC, 0x81, 0xC9, 0x03, 0x79, 0xCC, + 0x82, 0xC9, 0x03, 0x79, 0xCC, 0x83, 0xC9, 0x03, + 0x79, 0xCC, 0x84, 0xC9, 0x03, 0x79, 0xCC, 0x87, + 0xC9, 0x03, 0x79, 0xCC, 0x88, 0xC9, 0x03, 0x79, + 0xCC, 0x89, 0xC9, 0x03, 0x79, 0xCC, 0x8A, 0xC9, + 0x03, 0x79, 0xCC, 0xA3, 0xB5, 0x03, 0x7A, 0xCC, + // Bytes 3580 - 35bf + 0x81, 0xC9, 0x03, 0x7A, 0xCC, 0x82, 0xC9, 0x03, + 0x7A, 0xCC, 0x87, 0xC9, 0x03, 0x7A, 0xCC, 0x8C, + 0xC9, 0x03, 0x7A, 0xCC, 0xA3, 0xB5, 0x03, 0x7A, + 0xCC, 0xB1, 0xB5, 0x04, 0xC2, 0xA8, 0xCC, 0x80, + 0xCA, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x04, + 0xC2, 0xA8, 0xCD, 0x82, 0xCA, 0x04, 0xC3, 0x86, + 0xCC, 0x81, 0xC9, 0x04, 0xC3, 0x86, 0xCC, 0x84, + 0xC9, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xC9, 0x04, + // Bytes 35c0 - 35ff + 0xC3, 0xA6, 0xCC, 0x81, 0xC9, 0x04, 0xC3, 0xA6, + 0xCC, 0x84, 0xC9, 0x04, 0xC3, 0xB8, 0xCC, 0x81, + 0xC9, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xC9, 0x04, + 0xC6, 0xB7, 0xCC, 0x8C, 0xC9, 0x04, 0xCA, 0x92, + 0xCC, 0x8C, 0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x80, + 0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xC9, 0x04, + 0xCE, 0x91, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0x91, + 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0x91, 0xCD, 0x85, + // Bytes 3600 - 363f + 0xD9, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xC9, 0x04, + 0xCE, 0x95, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x97, + 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x97, 0xCC, 0x81, + 0xC9, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xD9, 0x04, + 0xCE, 0x99, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x99, + 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x84, + 0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xC9, 0x04, + 0xCE, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0x9F, + // Bytes 3640 - 367f + 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x9F, 0xCC, 0x81, + 0xC9, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xC9, 0x04, + 0xCE, 0xA5, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA5, + 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x84, + 0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xC9, 0x04, + 0xCE, 0xA5, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0xA9, + 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA9, 0xCC, 0x81, + 0xC9, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xD9, 0x04, + // Bytes 3680 - 36bf + 0xCE, 0xB1, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB1, + 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB1, 0xCD, 0x85, + 0xD9, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xC9, 0x04, + 0xCE, 0xB5, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xB7, + 0xCD, 0x85, 0xD9, 0x04, 0xCE, 0xB9, 0xCC, 0x80, + 0xC9, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x04, + 0xCE, 0xB9, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB9, + 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB9, 0xCD, 0x82, + // Bytes 36c0 - 36ff + 0xC9, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xC9, 0x04, + 0xCE, 0xBF, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x81, + 0xCC, 0x93, 0xC9, 0x04, 0xCF, 0x81, 0xCC, 0x94, + 0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xC9, 0x04, + 0xCF, 0x85, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x85, + 0xCC, 0x84, 0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x86, + 0xC9, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xC9, 0x04, + 0xCF, 0x89, 0xCD, 0x85, 0xD9, 0x04, 0xCF, 0x92, + // Bytes 3700 - 373f + 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x92, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0x90, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x90, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x93, 0xCC, 0x81, + 0xC9, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xC9, 0x04, + 0xD0, 0x95, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x95, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x86, + 0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xC9, 0x04, + // Bytes 3740 - 377f + 0xD0, 0x97, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x98, + 0xCC, 0x80, 0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x84, + 0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xC9, 0x04, + 0xD0, 0x98, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x9A, + 0xCC, 0x81, 0xC9, 0x04, 0xD0, 0x9E, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xC9, 0x04, + 0xD0, 0xA3, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xA3, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x8B, + // Bytes 3780 - 37bf + 0xC9, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0xAB, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xAD, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x86, + 0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0xB3, 0xCC, 0x81, 0xC9, 0x04, 0xD0, 0xB5, + 0xCC, 0x80, 0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x86, + 0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0xB6, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB6, + // Bytes 37c0 - 37ff + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB7, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xC9, 0x04, + 0xD0, 0xB8, 0xCC, 0x84, 0xC9, 0x04, 0xD0, 0xB8, + 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xC9, 0x04, + 0xD0, 0xBE, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x83, + 0xCC, 0x84, 0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x86, + 0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xC9, 0x04, + // Bytes 3800 - 383f + 0xD1, 0x83, 0xCC, 0x8B, 0xC9, 0x04, 0xD1, 0x87, + 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x8B, 0xCC, 0x88, + 0xC9, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xC9, 0x04, + 0xD1, 0x96, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0xB4, + 0xCC, 0x8F, 0xC9, 0x04, 0xD1, 0xB5, 0xCC, 0x8F, + 0xC9, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xC9, 0x04, + 0xD3, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA8, + 0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA9, 0xCC, 0x88, + // Bytes 3840 - 387f + 0xC9, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xC9, 0x04, + 0xD8, 0xA7, 0xD9, 0x94, 0xC9, 0x04, 0xD8, 0xA7, + 0xD9, 0x95, 0xB5, 0x04, 0xD9, 0x88, 0xD9, 0x94, + 0xC9, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, 0x04, + 0xDB, 0x81, 0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x92, + 0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x95, 0xD9, 0x94, + 0xC9, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, 0xCA, + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, + // Bytes 3880 - 38bf + 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x41, + 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x80, 0xCA, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x81, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x83, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x89, + 0xCA, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, 0xCA, + 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, + 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x41, + // Bytes 38c0 - 38ff + 0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x41, 0xCC, + 0xA3, 0xCC, 0x86, 0xCA, 0x05, 0x43, 0xCC, 0xA7, + 0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x80, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x81, + 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, 0xCA, + 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x45, + 0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC, + // Bytes 3900 - 393f + 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x45, 0xCC, 0xA7, + 0xCC, 0x86, 0xCA, 0x05, 0x49, 0xCC, 0x88, 0xCC, + 0x81, 0xCA, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCA, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, 0xCA, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x4F, + 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x4F, 0xCC, + 0x83, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x83, + // Bytes 3940 - 397f + 0xCC, 0x84, 0xCA, 0x05, 0x4F, 0xCC, 0x83, 0xCC, + 0x88, 0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x80, + 0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, 0xCA, + 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, + 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + // Bytes 3980 - 39bf + 0x89, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xB6, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA, + 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05, + 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x53, + 0xCC, 0x81, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC, + 0x8C, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC, 0xA3, + 0xCC, 0x87, 0xCA, 0x05, 0x55, 0xCC, 0x83, 0xCC, + 0x81, 0xCA, 0x05, 0x55, 0xCC, 0x84, 0xCC, 0x88, + // Bytes 39c0 - 39ff + 0xCA, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, 0xCA, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x55, + 0xCC, 0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x81, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x83, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x89, + 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, + // Bytes 3a00 - 3a3f + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x61, 0xCC, + 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x80, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x81, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x83, + 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, 0xCA, + 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, + // Bytes 3a40 - 3a7f + 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x61, + 0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x61, 0xCC, 0xA3, + 0xCC, 0x86, 0xCA, 0x05, 0x63, 0xCC, 0xA7, 0xCC, + 0x81, 0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x80, + 0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, 0xCA, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, + 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x65, + // Bytes 3a80 - 3abf + 0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x65, 0xCC, + 0x84, 0xCC, 0x81, 0xCA, 0x05, 0x65, 0xCC, 0xA3, + 0xCC, 0x82, 0xCA, 0x05, 0x65, 0xCC, 0xA7, 0xCC, + 0x86, 0xCA, 0x05, 0x69, 0xCC, 0x88, 0xCC, 0x81, + 0xCA, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, 0xCA, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x6F, + 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x6F, 0xCC, + // Bytes 3ac0 - 3aff + 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x84, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x88, + 0xCA, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, 0xCA, + 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05, + 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, 0x6F, + 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x6F, 0xCC, + 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, + // Bytes 3b00 - 3b3f + 0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x83, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x89, + 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, + 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05, + 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05, 0x72, + 0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x73, 0xCC, + 0x81, 0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0x8C, + 0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0xA3, 0xCC, + // Bytes 3b40 - 3b7f + 0x87, 0xCA, 0x05, 0x75, 0xCC, 0x83, 0xCC, 0x81, + 0xCA, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, 0xCA, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCA, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x75, 0xCC, + 0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x80, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + 0x81, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x83, + // Bytes 3b80 - 3bbf + 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, 0xCA, + 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCA, 0x05, 0xE1, + 0xBE, 0xBF, 0xCC, 0x81, 0xCA, 0x05, 0xE1, 0xBE, + 0xBF, 0xCD, 0x82, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x80, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCC, + 0x81, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, 0x82, + 0xCA, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, 0x05, + // Bytes 3bc0 - 3bff + 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x94, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3c00 - 3c3f + 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x85, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3c40 - 3c7f + 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB6, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3c80 - 3cbf + 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x86, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB2, + // Bytes 3cc0 - 3cff + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, 0x05, + 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + // Bytes 3d00 - 3d3f + 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + // Bytes 3d40 - 3d7f + 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + // Bytes 3d80 - 3dbf + 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + // Bytes 3dc0 - 3dff + 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, 0xDA, + // Bytes 3e00 - 3e3f + 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + // Bytes 3e40 - 3e7f + 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, 0xCA, + // Bytes 3e80 - 3ebf + 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, 0xDA, + 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, 0xDA, + // Bytes 3ec0 - 3eff + 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, 0xDA, + 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, 0x09, + 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, 0x09, + 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, 0x09, + 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, 0x85, + 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, 0x11, + // Bytes 3f00 - 3f3f + 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 3f40 - 3f7f + 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 3f80 - 3fbf + 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, 0x0D, + // Bytes 3fc0 - 3fff + 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 4000 - 403f + 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 4040 - 407f + 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 4080 - 40bf + 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 40c0 - 40ff + 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, 0x0D, + 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, + 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, + 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCD, + // Bytes 4100 - 413f + 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCD, + 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, + 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, 0x94, 0xCC, + 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, + 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + // Bytes 4140 - 417f + 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, + 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, + 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, + // Bytes 4180 - 41bf + 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, + 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, 0x94, 0xCC, + 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, + 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB, + // Bytes 41c0 - 41ff + 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, + 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, + 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, + 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, + // Bytes 4200 - 423f + 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF, + 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB, + 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCD, + 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, 0x94, 0xCC, + 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, + 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCF, + 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB, + 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, 0x82, + // Bytes 4240 - 427f + 0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82, 0x9B, 0xF0, + 0x91, 0x82, 0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82, + 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x09, 0x42, 0xC2, + 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xC9, 0x43, + 0x20, 0xCC, 0x83, 0xC9, 0x43, 0x20, 0xCC, 0x84, + 0xC9, 0x43, 0x20, 0xCC, 0x85, 0xC9, 0x43, 0x20, + 0xCC, 0x86, 0xC9, 0x43, 0x20, 0xCC, 0x87, 0xC9, + 0x43, 0x20, 0xCC, 0x88, 0xC9, 0x43, 0x20, 0xCC, + // Bytes 4280 - 42bf + 0x8A, 0xC9, 0x43, 0x20, 0xCC, 0x8B, 0xC9, 0x43, + 0x20, 0xCC, 0x93, 0xC9, 0x43, 0x20, 0xCC, 0x94, + 0xC9, 0x43, 0x20, 0xCC, 0xA7, 0xA5, 0x43, 0x20, + 0xCC, 0xA8, 0xA5, 0x43, 0x20, 0xCC, 0xB3, 0xB5, + 0x43, 0x20, 0xCD, 0x82, 0xC9, 0x43, 0x20, 0xCD, + 0x85, 0xD9, 0x43, 0x20, 0xD9, 0x8B, 0x59, 0x43, + 0x20, 0xD9, 0x8C, 0x5D, 0x43, 0x20, 0xD9, 0x8D, + 0x61, 0x43, 0x20, 0xD9, 0x8E, 0x65, 0x43, 0x20, + // Bytes 42c0 - 42ff + 0xD9, 0x8F, 0x69, 0x43, 0x20, 0xD9, 0x90, 0x6D, + 0x43, 0x20, 0xD9, 0x91, 0x71, 0x43, 0x20, 0xD9, + 0x92, 0x75, 0x43, 0x41, 0xCC, 0x8A, 0xC9, 0x43, + 0x73, 0xCC, 0x87, 0xC9, 0x44, 0x20, 0xE3, 0x82, + 0x99, 0x0D, 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D, + 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE, + 0x91, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9, + // Bytes 4300 - 433f + 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0x9F, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9, + 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xB1, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, + 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xBF, 0xCC, 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC, + // Bytes 4340 - 437f + 0x81, 0xC9, 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9, + 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7, + 0x90, 0xD6, 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x92, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7, + // Bytes 4380 - 43bf + 0x95, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7, + 0x99, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x9C, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41, + // Bytes 43c0 - 43ff + 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA3, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49, + 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA7, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7, + 0xA9, 0xD7, 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6, + // Bytes 4400 - 443f + 0xBC, 0x41, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31, + 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8, + 0xA7, 0xD9, 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, + 0x94, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, + 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8, + 0xB1, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9, + 0x8B, 0x59, 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65, + 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9, + // Bytes 4440 - 447f + 0x80, 0xD9, 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9, + 0x91, 0x71, 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75, + 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9, + 0x88, 0xD9, 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9, + 0xB0, 0x79, 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, + 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB, + 0x95, 0xD9, 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88, + 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC, + // Bytes 4480 - 44bf + 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82, + 0xCA, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45, + 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, + 0x94, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94, + 0xCD, 0x82, 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9, + 0x91, 0x72, 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91, + // Bytes 44c0 - 44ff + 0x72, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72, + 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45, + 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20, + 0xD9, 0x91, 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB, + 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6, + 0xBC, 0xD7, 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6, + // Bytes 4500 - 453f + 0xBC, 0xD7, 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9, + 0x8E, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x8F, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x90, 0xD9, 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1, + // Bytes 4540 - 457f + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97, + // Bytes 4580 - 45bf + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3, + // Bytes 45c0 - 45ff + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86, + 0xE3, 0x82, 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85, + 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, + 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, + 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + 0x9D, 0x85, 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49, + // Bytes 4600 - 463f + 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, + 0x80, 0x9E, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, + 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, + 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, + 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, + 0x9D, 0x85, 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, + 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + // Bytes 4640 - 467f + 0xB1, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE, + 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, + 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, + 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, + 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + // Bytes 4680 - 46bf + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, + 0x83, 0x41, 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC, + 0x86, 0xC9, 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83, + 0x41, 0xCC, 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A, + 0xC9, 0x83, 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43, + 0xCC, 0xA7, 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9, + 0x83, 0x45, 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC, + 0xA3, 0xB5, 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83, + // Bytes 46c0 - 46ff + 0x49, 0xCC, 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3, + 0xB5, 0x83, 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F, + 0xCC, 0x83, 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9, + 0x83, 0x4F, 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC, + 0x88, 0xC9, 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83, + 0x4F, 0xCC, 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8, + 0xA5, 0x83, 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53, + 0xCC, 0x81, 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9, + // Bytes 4700 - 473f + 0x83, 0x53, 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC, + 0x83, 0xC9, 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83, + 0x55, 0xCC, 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B, + 0xAD, 0x83, 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61, + 0xCC, 0x86, 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9, + 0x83, 0x61, 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC, + 0x8A, 0xC9, 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83, + 0x63, 0xCC, 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82, + // Bytes 4740 - 477f + 0xC9, 0x83, 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65, + 0xCC, 0xA3, 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5, + 0x83, 0x69, 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC, + 0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83, + 0x6F, 0xCC, 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84, + 0xC9, 0x83, 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F, + 0xCC, 0x88, 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD, + 0x83, 0x6F, 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC, + // Bytes 4780 - 47bf + 0xA8, 0xA5, 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83, + 0x73, 0xCC, 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C, + 0xC9, 0x83, 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75, + 0xCC, 0x83, 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9, + 0x83, 0x75, 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC, + 0x9B, 0xAD, 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x95, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC, + // Bytes 47c0 - 47ff + 0x94, 0xC9, 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x99, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0xA5, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE, + // Bytes 4800 - 483f + 0xB1, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE, + 0xB5, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9, + 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE, + 0xB7, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9, + // Bytes 4840 - 487f + 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE, + 0xB9, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF, + 0x85, 0xCC, 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC, + 0x93, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF, + 0x89, 0xCC, 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC, + // Bytes 4880 - 48bf + 0x93, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + // Bytes 48c0 - 48ff + 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + // Bytes 4900 - 493f + 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + // Bytes 4940 - 497f + 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF, + // Bytes 4980 - 49bf + 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC, + 0x80, 0xC9, 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32, + 0x42, 0xCC, 0x93, 0xC9, 0x32, 0x43, 0xE1, 0x85, + // Bytes 49c0 - 49ff + 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, 0x43, + // Bytes 4a00 - 4a3f + 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, 0x01, + // Bytes 4a40 - 4a7f + 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, 0x01, + 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, 0x01, + 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x32, + 0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, 0x43, 0xE3, + // Bytes 4a80 - 4abf + 0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, 0xBD, 0xB1, + 0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x26, 0x00, + 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10442 bytes (10.20 KiB). Checksum: 4ba400a9d8208e03. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 45: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 45 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 47 blocks, 3008 entries, 6016 bytes +// The third block is the zero block. +var nfcValues = [3008]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, + // Block 0x4, offset 0x100 + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, + 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, + 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, + 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, + 0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6, + 0x130: 0x308c, 0x134: 0x30b4, 0x135: 0x33c0, + 0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc, + 0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8, + // Block 0x5, offset 0x140 + 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, + 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, + 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, + 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140, + 0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8, + 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, + 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, + 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1b0: 0x33c5, 0x1b4: 0x3028, 0x1b5: 0x3334, + 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, + 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316, + 0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac, + 0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479, + 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, + 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, + 0x1de: 0x305a, 0x1df: 0x3366, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, + 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, + // Block 0x8, offset 0x200 + 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, + 0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932, + 0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932, + 0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d, + 0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d, + 0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d, + 0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d, + 0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d, + 0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, + 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, + // Block 0x9, offset 0x240 + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, + 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, + 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, + 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, + 0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135, + 0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132, + 0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132, + 0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132, + 0x274: 0x0170, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x35a1, + 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625, + 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, + 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3721, 0x2c1: 0x372d, 0x2c3: 0x371b, + 0x2c6: 0xa000, 0x2c7: 0x3709, + 0x2cc: 0x375d, 0x2cd: 0x3745, 0x2ce: 0x376f, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3751, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x37d5, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3733, 0x302: 0x37b7, + 0x310: 0x370f, 0x311: 0x3793, + 0x312: 0x3715, 0x313: 0x3799, 0x316: 0x3727, 0x317: 0x37ab, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x3829, 0x31b: 0x382f, 0x31c: 0x3739, 0x31d: 0x37bd, + 0x31e: 0x373f, 0x31f: 0x37c3, 0x322: 0x374b, 0x323: 0x37cf, + 0x324: 0x3757, 0x325: 0x37db, 0x326: 0x3763, 0x327: 0x37e7, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3835, 0x32b: 0x383b, 0x32c: 0x378d, 0x32d: 0x3811, 0x32e: 0x3769, 0x32f: 0x37ed, + 0x330: 0x3775, 0x331: 0x37f9, 0x332: 0x377b, 0x333: 0x37ff, 0x334: 0x3781, 0x335: 0x3805, + 0x338: 0x3787, 0x339: 0x380b, + // Block 0xd, offset 0x340 + 0x351: 0x812d, + 0x352: 0x8132, 0x353: 0x8132, 0x354: 0x8132, 0x355: 0x8132, 0x356: 0x812d, 0x357: 0x8132, + 0x358: 0x8132, 0x359: 0x8132, 0x35a: 0x812e, 0x35b: 0x812d, 0x35c: 0x8132, 0x35d: 0x8132, + 0x35e: 0x8132, 0x35f: 0x8132, 0x360: 0x8132, 0x361: 0x8132, 0x362: 0x812d, 0x363: 0x812d, + 0x364: 0x812d, 0x365: 0x812d, 0x366: 0x812d, 0x367: 0x812d, 0x368: 0x8132, 0x369: 0x8132, + 0x36a: 0x812d, 0x36b: 0x8132, 0x36c: 0x8132, 0x36d: 0x812e, 0x36e: 0x8131, 0x36f: 0x8132, + 0x370: 0x8105, 0x371: 0x8106, 0x372: 0x8107, 0x373: 0x8108, 0x374: 0x8109, 0x375: 0x810a, + 0x376: 0x810b, 0x377: 0x810c, 0x378: 0x810d, 0x379: 0x810e, 0x37a: 0x810e, 0x37b: 0x810f, + 0x37c: 0x8110, 0x37d: 0x8111, 0x37f: 0x8112, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8116, + 0x38c: 0x8117, 0x38d: 0x8118, 0x38e: 0x8119, 0x38f: 0x811a, 0x390: 0x811b, 0x391: 0x811c, + 0x392: 0x811d, 0x393: 0x9932, 0x394: 0x9932, 0x395: 0x992d, 0x396: 0x812d, 0x397: 0x8132, + 0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x8132, 0x39b: 0x8132, 0x39c: 0x812d, 0x39d: 0x8132, + 0x39e: 0x8132, 0x39f: 0x812d, + 0x3b0: 0x811e, + // Block 0xf, offset 0x3c0 + 0x3c5: 0xa000, + 0x3c6: 0x2d26, 0x3c7: 0xa000, 0x3c8: 0x2d2e, 0x3c9: 0xa000, 0x3ca: 0x2d36, 0x3cb: 0xa000, + 0x3cc: 0x2d3e, 0x3cd: 0xa000, 0x3ce: 0x2d46, 0x3d1: 0xa000, + 0x3d2: 0x2d4e, + 0x3f4: 0x8102, 0x3f5: 0x9900, + 0x3fa: 0xa000, 0x3fb: 0x2d56, + 0x3fc: 0xa000, 0x3fd: 0x2d5e, 0x3fe: 0xa000, 0x3ff: 0xa000, + // Block 0x10, offset 0x400 + 0x400: 0x8132, 0x401: 0x8132, 0x402: 0x812d, 0x403: 0x8132, 0x404: 0x8132, 0x405: 0x8132, + 0x406: 0x8132, 0x407: 0x8132, 0x408: 0x8132, 0x409: 0x8132, 0x40a: 0x812d, 0x40b: 0x8132, + 0x40c: 0x8132, 0x40d: 0x8135, 0x40e: 0x812a, 0x40f: 0x812d, 0x410: 0x8129, 0x411: 0x8132, + 0x412: 0x8132, 0x413: 0x8132, 0x414: 0x8132, 0x415: 0x8132, 0x416: 0x8132, 0x417: 0x8132, + 0x418: 0x8132, 0x419: 0x8132, 0x41a: 0x8132, 0x41b: 0x8132, 0x41c: 0x8132, 0x41d: 0x8132, + 0x41e: 0x8132, 0x41f: 0x8132, 0x420: 0x8132, 0x421: 0x8132, 0x422: 0x8132, 0x423: 0x8132, + 0x424: 0x8132, 0x425: 0x8132, 0x426: 0x8132, 0x427: 0x8132, 0x428: 0x8132, 0x429: 0x8132, + 0x42a: 0x8132, 0x42b: 0x8132, 0x42c: 0x8132, 0x42d: 0x8132, 0x42e: 0x8132, 0x42f: 0x8132, + 0x430: 0x8132, 0x431: 0x8132, 0x432: 0x8132, 0x433: 0x8132, 0x434: 0x8132, 0x435: 0x8132, + 0x436: 0x8133, 0x437: 0x8131, 0x438: 0x8131, 0x439: 0x812d, 0x43b: 0x8132, + 0x43c: 0x8134, 0x43d: 0x812d, 0x43e: 0x8132, 0x43f: 0x812d, + // Block 0x11, offset 0x440 + 0x440: 0x2f97, 0x441: 0x32a3, 0x442: 0x2fa1, 0x443: 0x32ad, 0x444: 0x2fa6, 0x445: 0x32b2, + 0x446: 0x2fab, 0x447: 0x32b7, 0x448: 0x38cc, 0x449: 0x3a5b, 0x44a: 0x2fc4, 0x44b: 0x32d0, + 0x44c: 0x2fce, 0x44d: 0x32da, 0x44e: 0x2fdd, 0x44f: 0x32e9, 0x450: 0x2fd3, 0x451: 0x32df, + 0x452: 0x2fd8, 0x453: 0x32e4, 0x454: 0x38ef, 0x455: 0x3a7e, 0x456: 0x38f6, 0x457: 0x3a85, + 0x458: 0x3019, 0x459: 0x3325, 0x45a: 0x301e, 0x45b: 0x332a, 0x45c: 0x3904, 0x45d: 0x3a93, + 0x45e: 0x3023, 0x45f: 0x332f, 0x460: 0x3032, 0x461: 0x333e, 0x462: 0x3050, 0x463: 0x335c, + 0x464: 0x305f, 0x465: 0x336b, 0x466: 0x3055, 0x467: 0x3361, 0x468: 0x3064, 0x469: 0x3370, + 0x46a: 0x3069, 0x46b: 0x3375, 0x46c: 0x30af, 0x46d: 0x33bb, 0x46e: 0x390b, 0x46f: 0x3a9a, + 0x470: 0x30b9, 0x471: 0x33ca, 0x472: 0x30c3, 0x473: 0x33d4, 0x474: 0x30cd, 0x475: 0x33de, + 0x476: 0x46c4, 0x477: 0x4755, 0x478: 0x3912, 0x479: 0x3aa1, 0x47a: 0x30e6, 0x47b: 0x33f7, + 0x47c: 0x30e1, 0x47d: 0x33f2, 0x47e: 0x30eb, 0x47f: 0x33fc, + // Block 0x12, offset 0x480 + 0x480: 0x30f0, 0x481: 0x3401, 0x482: 0x30f5, 0x483: 0x3406, 0x484: 0x3109, 0x485: 0x341a, + 0x486: 0x3113, 0x487: 0x3424, 0x488: 0x3122, 0x489: 0x3433, 0x48a: 0x311d, 0x48b: 0x342e, + 0x48c: 0x3935, 0x48d: 0x3ac4, 0x48e: 0x3943, 0x48f: 0x3ad2, 0x490: 0x394a, 0x491: 0x3ad9, + 0x492: 0x3951, 0x493: 0x3ae0, 0x494: 0x314f, 0x495: 0x3460, 0x496: 0x3154, 0x497: 0x3465, + 0x498: 0x315e, 0x499: 0x346f, 0x49a: 0x46f1, 0x49b: 0x4782, 0x49c: 0x3997, 0x49d: 0x3b26, + 0x49e: 0x3177, 0x49f: 0x3488, 0x4a0: 0x3181, 0x4a1: 0x3492, 0x4a2: 0x4700, 0x4a3: 0x4791, + 0x4a4: 0x399e, 0x4a5: 0x3b2d, 0x4a6: 0x39a5, 0x4a7: 0x3b34, 0x4a8: 0x39ac, 0x4a9: 0x3b3b, + 0x4aa: 0x3190, 0x4ab: 0x34a1, 0x4ac: 0x319a, 0x4ad: 0x34b0, 0x4ae: 0x31ae, 0x4af: 0x34c4, + 0x4b0: 0x31a9, 0x4b1: 0x34bf, 0x4b2: 0x31ea, 0x4b3: 0x3500, 0x4b4: 0x31f9, 0x4b5: 0x350f, + 0x4b6: 0x31f4, 0x4b7: 0x350a, 0x4b8: 0x39b3, 0x4b9: 0x3b42, 0x4ba: 0x39ba, 0x4bb: 0x3b49, + 0x4bc: 0x31fe, 0x4bd: 0x3514, 0x4be: 0x3203, 0x4bf: 0x3519, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3208, 0x4c1: 0x351e, 0x4c2: 0x320d, 0x4c3: 0x3523, 0x4c4: 0x321c, 0x4c5: 0x3532, + 0x4c6: 0x3217, 0x4c7: 0x352d, 0x4c8: 0x3221, 0x4c9: 0x353c, 0x4ca: 0x3226, 0x4cb: 0x3541, + 0x4cc: 0x322b, 0x4cd: 0x3546, 0x4ce: 0x3249, 0x4cf: 0x3564, 0x4d0: 0x3262, 0x4d1: 0x3582, + 0x4d2: 0x3271, 0x4d3: 0x3591, 0x4d4: 0x3276, 0x4d5: 0x3596, 0x4d6: 0x337a, 0x4d7: 0x34a6, + 0x4d8: 0x3537, 0x4d9: 0x3573, 0x4db: 0x35d1, + 0x4e0: 0x46a1, 0x4e1: 0x4732, 0x4e2: 0x2f83, 0x4e3: 0x328f, + 0x4e4: 0x3878, 0x4e5: 0x3a07, 0x4e6: 0x3871, 0x4e7: 0x3a00, 0x4e8: 0x3886, 0x4e9: 0x3a15, + 0x4ea: 0x387f, 0x4eb: 0x3a0e, 0x4ec: 0x38be, 0x4ed: 0x3a4d, 0x4ee: 0x3894, 0x4ef: 0x3a23, + 0x4f0: 0x388d, 0x4f1: 0x3a1c, 0x4f2: 0x38a2, 0x4f3: 0x3a31, 0x4f4: 0x389b, 0x4f5: 0x3a2a, + 0x4f6: 0x38c5, 0x4f7: 0x3a54, 0x4f8: 0x46b5, 0x4f9: 0x4746, 0x4fa: 0x3000, 0x4fb: 0x330c, + 0x4fc: 0x2fec, 0x4fd: 0x32f8, 0x4fe: 0x38da, 0x4ff: 0x3a69, + // Block 0x14, offset 0x500 + 0x500: 0x38d3, 0x501: 0x3a62, 0x502: 0x38e8, 0x503: 0x3a77, 0x504: 0x38e1, 0x505: 0x3a70, + 0x506: 0x38fd, 0x507: 0x3a8c, 0x508: 0x3091, 0x509: 0x339d, 0x50a: 0x30a5, 0x50b: 0x33b1, + 0x50c: 0x46e7, 0x50d: 0x4778, 0x50e: 0x3136, 0x50f: 0x3447, 0x510: 0x3920, 0x511: 0x3aaf, + 0x512: 0x3919, 0x513: 0x3aa8, 0x514: 0x392e, 0x515: 0x3abd, 0x516: 0x3927, 0x517: 0x3ab6, + 0x518: 0x3989, 0x519: 0x3b18, 0x51a: 0x396d, 0x51b: 0x3afc, 0x51c: 0x3966, 0x51d: 0x3af5, + 0x51e: 0x397b, 0x51f: 0x3b0a, 0x520: 0x3974, 0x521: 0x3b03, 0x522: 0x3982, 0x523: 0x3b11, + 0x524: 0x31e5, 0x525: 0x34fb, 0x526: 0x31c7, 0x527: 0x34dd, 0x528: 0x39e4, 0x529: 0x3b73, + 0x52a: 0x39dd, 0x52b: 0x3b6c, 0x52c: 0x39f2, 0x52d: 0x3b81, 0x52e: 0x39eb, 0x52f: 0x3b7a, + 0x530: 0x39f9, 0x531: 0x3b88, 0x532: 0x3230, 0x533: 0x354b, 0x534: 0x3258, 0x535: 0x3578, + 0x536: 0x3253, 0x537: 0x356e, 0x538: 0x323f, 0x539: 0x355a, + // Block 0x15, offset 0x540 + 0x540: 0x4804, 0x541: 0x480a, 0x542: 0x491e, 0x543: 0x4936, 0x544: 0x4926, 0x545: 0x493e, + 0x546: 0x492e, 0x547: 0x4946, 0x548: 0x47aa, 0x549: 0x47b0, 0x54a: 0x488e, 0x54b: 0x48a6, + 0x54c: 0x4896, 0x54d: 0x48ae, 0x54e: 0x489e, 0x54f: 0x48b6, 0x550: 0x4816, 0x551: 0x481c, + 0x552: 0x3db8, 0x553: 0x3dc8, 0x554: 0x3dc0, 0x555: 0x3dd0, + 0x558: 0x47b6, 0x559: 0x47bc, 0x55a: 0x3ce8, 0x55b: 0x3cf8, 0x55c: 0x3cf0, 0x55d: 0x3d00, + 0x560: 0x482e, 0x561: 0x4834, 0x562: 0x494e, 0x563: 0x4966, + 0x564: 0x4956, 0x565: 0x496e, 0x566: 0x495e, 0x567: 0x4976, 0x568: 0x47c2, 0x569: 0x47c8, + 0x56a: 0x48be, 0x56b: 0x48d6, 0x56c: 0x48c6, 0x56d: 0x48de, 0x56e: 0x48ce, 0x56f: 0x48e6, + 0x570: 0x4846, 0x571: 0x484c, 0x572: 0x3e18, 0x573: 0x3e30, 0x574: 0x3e20, 0x575: 0x3e38, + 0x576: 0x3e28, 0x577: 0x3e40, 0x578: 0x47ce, 0x579: 0x47d4, 0x57a: 0x3d18, 0x57b: 0x3d30, + 0x57c: 0x3d20, 0x57d: 0x3d38, 0x57e: 0x3d28, 0x57f: 0x3d40, + // Block 0x16, offset 0x580 + 0x580: 0x4852, 0x581: 0x4858, 0x582: 0x3e48, 0x583: 0x3e58, 0x584: 0x3e50, 0x585: 0x3e60, + 0x588: 0x47da, 0x589: 0x47e0, 0x58a: 0x3d48, 0x58b: 0x3d58, + 0x58c: 0x3d50, 0x58d: 0x3d60, 0x590: 0x4864, 0x591: 0x486a, + 0x592: 0x3e80, 0x593: 0x3e98, 0x594: 0x3e88, 0x595: 0x3ea0, 0x596: 0x3e90, 0x597: 0x3ea8, + 0x599: 0x47e6, 0x59b: 0x3d68, 0x59d: 0x3d70, + 0x59f: 0x3d78, 0x5a0: 0x487c, 0x5a1: 0x4882, 0x5a2: 0x497e, 0x5a3: 0x4996, + 0x5a4: 0x4986, 0x5a5: 0x499e, 0x5a6: 0x498e, 0x5a7: 0x49a6, 0x5a8: 0x47ec, 0x5a9: 0x47f2, + 0x5aa: 0x48ee, 0x5ab: 0x4906, 0x5ac: 0x48f6, 0x5ad: 0x490e, 0x5ae: 0x48fe, 0x5af: 0x4916, + 0x5b0: 0x47f8, 0x5b1: 0x431e, 0x5b2: 0x3691, 0x5b3: 0x4324, 0x5b4: 0x4822, 0x5b5: 0x432a, + 0x5b6: 0x36a3, 0x5b7: 0x4330, 0x5b8: 0x36c1, 0x5b9: 0x4336, 0x5ba: 0x36d9, 0x5bb: 0x433c, + 0x5bc: 0x4870, 0x5bd: 0x4342, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3da0, 0x5c1: 0x3da8, 0x5c2: 0x4184, 0x5c3: 0x41a2, 0x5c4: 0x418e, 0x5c5: 0x41ac, + 0x5c6: 0x4198, 0x5c7: 0x41b6, 0x5c8: 0x3cd8, 0x5c9: 0x3ce0, 0x5ca: 0x40d0, 0x5cb: 0x40ee, + 0x5cc: 0x40da, 0x5cd: 0x40f8, 0x5ce: 0x40e4, 0x5cf: 0x4102, 0x5d0: 0x3de8, 0x5d1: 0x3df0, + 0x5d2: 0x41c0, 0x5d3: 0x41de, 0x5d4: 0x41ca, 0x5d5: 0x41e8, 0x5d6: 0x41d4, 0x5d7: 0x41f2, + 0x5d8: 0x3d08, 0x5d9: 0x3d10, 0x5da: 0x410c, 0x5db: 0x412a, 0x5dc: 0x4116, 0x5dd: 0x4134, + 0x5de: 0x4120, 0x5df: 0x413e, 0x5e0: 0x3ec0, 0x5e1: 0x3ec8, 0x5e2: 0x41fc, 0x5e3: 0x421a, + 0x5e4: 0x4206, 0x5e5: 0x4224, 0x5e6: 0x4210, 0x5e7: 0x422e, 0x5e8: 0x3d80, 0x5e9: 0x3d88, + 0x5ea: 0x4148, 0x5eb: 0x4166, 0x5ec: 0x4152, 0x5ed: 0x4170, 0x5ee: 0x415c, 0x5ef: 0x417a, + 0x5f0: 0x3685, 0x5f1: 0x367f, 0x5f2: 0x3d90, 0x5f3: 0x368b, 0x5f4: 0x3d98, + 0x5f6: 0x4810, 0x5f7: 0x3db0, 0x5f8: 0x35f5, 0x5f9: 0x35ef, 0x5fa: 0x35e3, 0x5fb: 0x42ee, + 0x5fc: 0x35fb, 0x5fd: 0x8100, 0x5fe: 0x01d3, 0x5ff: 0xa100, + // Block 0x18, offset 0x600 + 0x600: 0x8100, 0x601: 0x35a7, 0x602: 0x3dd8, 0x603: 0x369d, 0x604: 0x3de0, + 0x606: 0x483a, 0x607: 0x3df8, 0x608: 0x3601, 0x609: 0x42f4, 0x60a: 0x360d, 0x60b: 0x42fa, + 0x60c: 0x3619, 0x60d: 0x3b8f, 0x60e: 0x3b96, 0x60f: 0x3b9d, 0x610: 0x36b5, 0x611: 0x36af, + 0x612: 0x3e00, 0x613: 0x44e4, 0x616: 0x36bb, 0x617: 0x3e10, + 0x618: 0x3631, 0x619: 0x362b, 0x61a: 0x361f, 0x61b: 0x4300, 0x61d: 0x3ba4, + 0x61e: 0x3bab, 0x61f: 0x3bb2, 0x620: 0x36eb, 0x621: 0x36e5, 0x622: 0x3e68, 0x623: 0x44ec, + 0x624: 0x36cd, 0x625: 0x36d3, 0x626: 0x36f1, 0x627: 0x3e78, 0x628: 0x3661, 0x629: 0x365b, + 0x62a: 0x364f, 0x62b: 0x430c, 0x62c: 0x3649, 0x62d: 0x359b, 0x62e: 0x42e8, 0x62f: 0x0081, + 0x632: 0x3eb0, 0x633: 0x36f7, 0x634: 0x3eb8, + 0x636: 0x4888, 0x637: 0x3ed0, 0x638: 0x363d, 0x639: 0x4306, 0x63a: 0x366d, 0x63b: 0x4318, + 0x63c: 0x3679, 0x63d: 0x4256, 0x63e: 0xa100, + // Block 0x19, offset 0x640 + 0x641: 0x3c06, 0x643: 0xa000, 0x644: 0x3c0d, 0x645: 0xa000, + 0x647: 0x3c14, 0x648: 0xa000, 0x649: 0x3c1b, + 0x64d: 0xa000, + 0x660: 0x2f65, 0x661: 0xa000, 0x662: 0x3c29, + 0x664: 0xa000, 0x665: 0xa000, + 0x66d: 0x3c22, 0x66e: 0x2f60, 0x66f: 0x2f6a, + 0x670: 0x3c30, 0x671: 0x3c37, 0x672: 0xa000, 0x673: 0xa000, 0x674: 0x3c3e, 0x675: 0x3c45, + 0x676: 0xa000, 0x677: 0xa000, 0x678: 0x3c4c, 0x679: 0x3c53, 0x67a: 0xa000, 0x67b: 0xa000, + 0x67c: 0xa000, 0x67d: 0xa000, + // Block 0x1a, offset 0x680 + 0x680: 0x3c5a, 0x681: 0x3c61, 0x682: 0xa000, 0x683: 0xa000, 0x684: 0x3c76, 0x685: 0x3c7d, + 0x686: 0xa000, 0x687: 0xa000, 0x688: 0x3c84, 0x689: 0x3c8b, + 0x691: 0xa000, + 0x692: 0xa000, + 0x6a2: 0xa000, + 0x6a8: 0xa000, 0x6a9: 0xa000, + 0x6ab: 0xa000, 0x6ac: 0x3ca0, 0x6ad: 0x3ca7, 0x6ae: 0x3cae, 0x6af: 0x3cb5, + 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0xa000, 0x6b5: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c6: 0xa000, 0x6cb: 0xa000, + 0x6cc: 0x3f08, 0x6cd: 0xa000, 0x6ce: 0x3f10, 0x6cf: 0xa000, 0x6d0: 0x3f18, 0x6d1: 0xa000, + 0x6d2: 0x3f20, 0x6d3: 0xa000, 0x6d4: 0x3f28, 0x6d5: 0xa000, 0x6d6: 0x3f30, 0x6d7: 0xa000, + 0x6d8: 0x3f38, 0x6d9: 0xa000, 0x6da: 0x3f40, 0x6db: 0xa000, 0x6dc: 0x3f48, 0x6dd: 0xa000, + 0x6de: 0x3f50, 0x6df: 0xa000, 0x6e0: 0x3f58, 0x6e1: 0xa000, 0x6e2: 0x3f60, + 0x6e4: 0xa000, 0x6e5: 0x3f68, 0x6e6: 0xa000, 0x6e7: 0x3f70, 0x6e8: 0xa000, 0x6e9: 0x3f78, + 0x6ef: 0xa000, + 0x6f0: 0x3f80, 0x6f1: 0x3f88, 0x6f2: 0xa000, 0x6f3: 0x3f90, 0x6f4: 0x3f98, 0x6f5: 0xa000, + 0x6f6: 0x3fa0, 0x6f7: 0x3fa8, 0x6f8: 0xa000, 0x6f9: 0x3fb0, 0x6fa: 0x3fb8, 0x6fb: 0xa000, + 0x6fc: 0x3fc0, 0x6fd: 0x3fc8, + // Block 0x1c, offset 0x700 + 0x714: 0x3f00, + 0x719: 0x9903, 0x71a: 0x9903, 0x71b: 0x8100, 0x71c: 0x8100, 0x71d: 0xa000, + 0x71e: 0x3fd0, + 0x726: 0xa000, + 0x72b: 0xa000, 0x72c: 0x3fe0, 0x72d: 0xa000, 0x72e: 0x3fe8, 0x72f: 0xa000, + 0x730: 0x3ff0, 0x731: 0xa000, 0x732: 0x3ff8, 0x733: 0xa000, 0x734: 0x4000, 0x735: 0xa000, + 0x736: 0x4008, 0x737: 0xa000, 0x738: 0x4010, 0x739: 0xa000, 0x73a: 0x4018, 0x73b: 0xa000, + 0x73c: 0x4020, 0x73d: 0xa000, 0x73e: 0x4028, 0x73f: 0xa000, + // Block 0x1d, offset 0x740 + 0x740: 0x4030, 0x741: 0xa000, 0x742: 0x4038, 0x744: 0xa000, 0x745: 0x4040, + 0x746: 0xa000, 0x747: 0x4048, 0x748: 0xa000, 0x749: 0x4050, + 0x74f: 0xa000, 0x750: 0x4058, 0x751: 0x4060, + 0x752: 0xa000, 0x753: 0x4068, 0x754: 0x4070, 0x755: 0xa000, 0x756: 0x4078, 0x757: 0x4080, + 0x758: 0xa000, 0x759: 0x4088, 0x75a: 0x4090, 0x75b: 0xa000, 0x75c: 0x4098, 0x75d: 0x40a0, + 0x76f: 0xa000, + 0x770: 0xa000, 0x771: 0xa000, 0x772: 0xa000, 0x774: 0x3fd8, + 0x777: 0x40a8, 0x778: 0x40b0, 0x779: 0x40b8, 0x77a: 0x40c0, + 0x77d: 0xa000, 0x77e: 0x40c8, + // Block 0x1e, offset 0x780 + 0x780: 0x1377, 0x781: 0x0cfb, 0x782: 0x13d3, 0x783: 0x139f, 0x784: 0x0e57, 0x785: 0x06eb, + 0x786: 0x08df, 0x787: 0x162b, 0x788: 0x162b, 0x789: 0x0a0b, 0x78a: 0x145f, 0x78b: 0x0943, + 0x78c: 0x0a07, 0x78d: 0x0bef, 0x78e: 0x0fcf, 0x78f: 0x115f, 0x790: 0x1297, 0x791: 0x12d3, + 0x792: 0x1307, 0x793: 0x141b, 0x794: 0x0d73, 0x795: 0x0dff, 0x796: 0x0eab, 0x797: 0x0f43, + 0x798: 0x125f, 0x799: 0x1447, 0x79a: 0x1573, 0x79b: 0x070f, 0x79c: 0x08b3, 0x79d: 0x0d87, + 0x79e: 0x0ecf, 0x79f: 0x1293, 0x7a0: 0x15c3, 0x7a1: 0x0ab3, 0x7a2: 0x0e77, 0x7a3: 0x1283, + 0x7a4: 0x1317, 0x7a5: 0x0c23, 0x7a6: 0x11bb, 0x7a7: 0x12df, 0x7a8: 0x0b1f, 0x7a9: 0x0d0f, + 0x7aa: 0x0e17, 0x7ab: 0x0f1b, 0x7ac: 0x1427, 0x7ad: 0x074f, 0x7ae: 0x07e7, 0x7af: 0x0853, + 0x7b0: 0x0c8b, 0x7b1: 0x0d7f, 0x7b2: 0x0ecb, 0x7b3: 0x0fef, 0x7b4: 0x1177, 0x7b5: 0x128b, + 0x7b6: 0x12a3, 0x7b7: 0x13c7, 0x7b8: 0x14ef, 0x7b9: 0x15a3, 0x7ba: 0x15bf, 0x7bb: 0x102b, + 0x7bc: 0x106b, 0x7bd: 0x1123, 0x7be: 0x1243, 0x7bf: 0x147b, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x15cb, 0x7c1: 0x134b, 0x7c2: 0x09c7, 0x7c3: 0x0b3b, 0x7c4: 0x10db, 0x7c5: 0x119b, + 0x7c6: 0x0eff, 0x7c7: 0x1033, 0x7c8: 0x1397, 0x7c9: 0x14e7, 0x7ca: 0x09c3, 0x7cb: 0x0a8f, + 0x7cc: 0x0d77, 0x7cd: 0x0e2b, 0x7ce: 0x0e5f, 0x7cf: 0x1113, 0x7d0: 0x113b, 0x7d1: 0x14a7, + 0x7d2: 0x084f, 0x7d3: 0x11a7, 0x7d4: 0x07f3, 0x7d5: 0x07ef, 0x7d6: 0x1097, 0x7d7: 0x1127, + 0x7d8: 0x125b, 0x7d9: 0x14af, 0x7da: 0x1367, 0x7db: 0x0c27, 0x7dc: 0x0d73, 0x7dd: 0x1357, + 0x7de: 0x06f7, 0x7df: 0x0a63, 0x7e0: 0x0b93, 0x7e1: 0x0f2f, 0x7e2: 0x0faf, 0x7e3: 0x0873, + 0x7e4: 0x103b, 0x7e5: 0x075f, 0x7e6: 0x0b77, 0x7e7: 0x06d7, 0x7e8: 0x0deb, 0x7e9: 0x0ca3, + 0x7ea: 0x110f, 0x7eb: 0x08c7, 0x7ec: 0x09b3, 0x7ed: 0x0ffb, 0x7ee: 0x1263, 0x7ef: 0x133b, + 0x7f0: 0x0db7, 0x7f1: 0x13f7, 0x7f2: 0x0de3, 0x7f3: 0x0c37, 0x7f4: 0x121b, 0x7f5: 0x0c57, + 0x7f6: 0x0fab, 0x7f7: 0x072b, 0x7f8: 0x07a7, 0x7f9: 0x07eb, 0x7fa: 0x0d53, 0x7fb: 0x10fb, + 0x7fc: 0x11f3, 0x7fd: 0x1347, 0x7fe: 0x145b, 0x7ff: 0x085b, + // Block 0x20, offset 0x800 + 0x800: 0x090f, 0x801: 0x0a17, 0x802: 0x0b2f, 0x803: 0x0cbf, 0x804: 0x0e7b, 0x805: 0x103f, + 0x806: 0x1497, 0x807: 0x157b, 0x808: 0x15cf, 0x809: 0x15e7, 0x80a: 0x0837, 0x80b: 0x0cf3, + 0x80c: 0x0da3, 0x80d: 0x13eb, 0x80e: 0x0afb, 0x80f: 0x0bd7, 0x810: 0x0bf3, 0x811: 0x0c83, + 0x812: 0x0e6b, 0x813: 0x0eb7, 0x814: 0x0f67, 0x815: 0x108b, 0x816: 0x112f, 0x817: 0x1193, + 0x818: 0x13db, 0x819: 0x126b, 0x81a: 0x1403, 0x81b: 0x147f, 0x81c: 0x080f, 0x81d: 0x083b, + 0x81e: 0x0923, 0x81f: 0x0ea7, 0x820: 0x12f3, 0x821: 0x133b, 0x822: 0x0b1b, 0x823: 0x0b8b, + 0x824: 0x0c4f, 0x825: 0x0daf, 0x826: 0x10d7, 0x827: 0x0f23, 0x828: 0x073b, 0x829: 0x097f, + 0x82a: 0x0a63, 0x82b: 0x0ac7, 0x82c: 0x0b97, 0x82d: 0x0f3f, 0x82e: 0x0f5b, 0x82f: 0x116b, + 0x830: 0x118b, 0x831: 0x1463, 0x832: 0x14e3, 0x833: 0x14f3, 0x834: 0x152f, 0x835: 0x0753, + 0x836: 0x107f, 0x837: 0x144f, 0x838: 0x14cb, 0x839: 0x0baf, 0x83a: 0x0717, 0x83b: 0x0777, + 0x83c: 0x0a67, 0x83d: 0x0a87, 0x83e: 0x0caf, 0x83f: 0x0d73, + // Block 0x21, offset 0x840 + 0x840: 0x0ec3, 0x841: 0x0fcb, 0x842: 0x1277, 0x843: 0x1417, 0x844: 0x1623, 0x845: 0x0ce3, + 0x846: 0x14a3, 0x847: 0x0833, 0x848: 0x0d2f, 0x849: 0x0d3b, 0x84a: 0x0e0f, 0x84b: 0x0e47, + 0x84c: 0x0f4b, 0x84d: 0x0fa7, 0x84e: 0x1027, 0x84f: 0x110b, 0x850: 0x153b, 0x851: 0x07af, + 0x852: 0x0c03, 0x853: 0x14b3, 0x854: 0x0767, 0x855: 0x0aab, 0x856: 0x0e2f, 0x857: 0x13df, + 0x858: 0x0b67, 0x859: 0x0bb7, 0x85a: 0x0d43, 0x85b: 0x0f2f, 0x85c: 0x14bb, 0x85d: 0x0817, + 0x85e: 0x08ff, 0x85f: 0x0a97, 0x860: 0x0cd3, 0x861: 0x0d1f, 0x862: 0x0d5f, 0x863: 0x0df3, + 0x864: 0x0f47, 0x865: 0x0fbb, 0x866: 0x1157, 0x867: 0x12f7, 0x868: 0x1303, 0x869: 0x1457, + 0x86a: 0x14d7, 0x86b: 0x0883, 0x86c: 0x0e4b, 0x86d: 0x0903, 0x86e: 0x0ec7, 0x86f: 0x0f6b, + 0x870: 0x1287, 0x871: 0x14bf, 0x872: 0x15ab, 0x873: 0x15d3, 0x874: 0x0d37, 0x875: 0x0e27, + 0x876: 0x11c3, 0x877: 0x10b7, 0x878: 0x10c3, 0x879: 0x10e7, 0x87a: 0x0f17, 0x87b: 0x0e9f, + 0x87c: 0x1363, 0x87d: 0x0733, 0x87e: 0x122b, 0x87f: 0x081b, + // Block 0x22, offset 0x880 + 0x880: 0x080b, 0x881: 0x0b0b, 0x882: 0x0c2b, 0x883: 0x10f3, 0x884: 0x0a53, 0x885: 0x0e03, + 0x886: 0x0cef, 0x887: 0x13e7, 0x888: 0x12e7, 0x889: 0x14ab, 0x88a: 0x1323, 0x88b: 0x0b27, + 0x88c: 0x0787, 0x88d: 0x095b, 0x890: 0x09af, + 0x892: 0x0cdf, 0x895: 0x07f7, 0x896: 0x0f1f, 0x897: 0x0fe3, + 0x898: 0x1047, 0x899: 0x1063, 0x89a: 0x1067, 0x89b: 0x107b, 0x89c: 0x14fb, 0x89d: 0x10eb, + 0x89e: 0x116f, 0x8a0: 0x128f, 0x8a2: 0x1353, + 0x8a5: 0x1407, 0x8a6: 0x1433, + 0x8aa: 0x154f, 0x8ab: 0x1553, 0x8ac: 0x1557, 0x8ad: 0x15bb, 0x8ae: 0x142b, 0x8af: 0x14c7, + 0x8b0: 0x0757, 0x8b1: 0x077b, 0x8b2: 0x078f, 0x8b3: 0x084b, 0x8b4: 0x0857, 0x8b5: 0x0897, + 0x8b6: 0x094b, 0x8b7: 0x0967, 0x8b8: 0x096f, 0x8b9: 0x09ab, 0x8ba: 0x09b7, 0x8bb: 0x0a93, + 0x8bc: 0x0a9b, 0x8bd: 0x0ba3, 0x8be: 0x0bcb, 0x8bf: 0x0bd3, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0beb, 0x8c1: 0x0c97, 0x8c2: 0x0cc7, 0x8c3: 0x0ce7, 0x8c4: 0x0d57, 0x8c5: 0x0e1b, + 0x8c6: 0x0e37, 0x8c7: 0x0e67, 0x8c8: 0x0ebb, 0x8c9: 0x0edb, 0x8ca: 0x0f4f, 0x8cb: 0x102f, + 0x8cc: 0x104b, 0x8cd: 0x1053, 0x8ce: 0x104f, 0x8cf: 0x1057, 0x8d0: 0x105b, 0x8d1: 0x105f, + 0x8d2: 0x1073, 0x8d3: 0x1077, 0x8d4: 0x109b, 0x8d5: 0x10af, 0x8d6: 0x10cb, 0x8d7: 0x112f, + 0x8d8: 0x1137, 0x8d9: 0x113f, 0x8da: 0x1153, 0x8db: 0x117b, 0x8dc: 0x11cb, 0x8dd: 0x11ff, + 0x8de: 0x11ff, 0x8df: 0x1267, 0x8e0: 0x130f, 0x8e1: 0x1327, 0x8e2: 0x135b, 0x8e3: 0x135f, + 0x8e4: 0x13a3, 0x8e5: 0x13a7, 0x8e6: 0x13ff, 0x8e7: 0x1407, 0x8e8: 0x14db, 0x8e9: 0x151f, + 0x8ea: 0x1537, 0x8eb: 0x0b9b, 0x8ec: 0x171e, 0x8ed: 0x11e3, + 0x8f0: 0x06df, 0x8f1: 0x07e3, 0x8f2: 0x07a3, 0x8f3: 0x074b, 0x8f4: 0x078b, 0x8f5: 0x07b7, + 0x8f6: 0x0847, 0x8f7: 0x0863, 0x8f8: 0x094b, 0x8f9: 0x0937, 0x8fa: 0x0947, 0x8fb: 0x0963, + 0x8fc: 0x09af, 0x8fd: 0x09bf, 0x8fe: 0x0a03, 0x8ff: 0x0a0f, + // Block 0x24, offset 0x900 + 0x900: 0x0a2b, 0x901: 0x0a3b, 0x902: 0x0b23, 0x903: 0x0b2b, 0x904: 0x0b5b, 0x905: 0x0b7b, + 0x906: 0x0bab, 0x907: 0x0bc3, 0x908: 0x0bb3, 0x909: 0x0bd3, 0x90a: 0x0bc7, 0x90b: 0x0beb, + 0x90c: 0x0c07, 0x90d: 0x0c5f, 0x90e: 0x0c6b, 0x90f: 0x0c73, 0x910: 0x0c9b, 0x911: 0x0cdf, + 0x912: 0x0d0f, 0x913: 0x0d13, 0x914: 0x0d27, 0x915: 0x0da7, 0x916: 0x0db7, 0x917: 0x0e0f, + 0x918: 0x0e5b, 0x919: 0x0e53, 0x91a: 0x0e67, 0x91b: 0x0e83, 0x91c: 0x0ebb, 0x91d: 0x1013, + 0x91e: 0x0edf, 0x91f: 0x0f13, 0x920: 0x0f1f, 0x921: 0x0f5f, 0x922: 0x0f7b, 0x923: 0x0f9f, + 0x924: 0x0fc3, 0x925: 0x0fc7, 0x926: 0x0fe3, 0x927: 0x0fe7, 0x928: 0x0ff7, 0x929: 0x100b, + 0x92a: 0x1007, 0x92b: 0x1037, 0x92c: 0x10b3, 0x92d: 0x10cb, 0x92e: 0x10e3, 0x92f: 0x111b, + 0x930: 0x112f, 0x931: 0x114b, 0x932: 0x117b, 0x933: 0x122f, 0x934: 0x1257, 0x935: 0x12cb, + 0x936: 0x1313, 0x937: 0x131f, 0x938: 0x1327, 0x939: 0x133f, 0x93a: 0x1353, 0x93b: 0x1343, + 0x93c: 0x135b, 0x93d: 0x1357, 0x93e: 0x134f, 0x93f: 0x135f, + // Block 0x25, offset 0x940 + 0x940: 0x136b, 0x941: 0x13a7, 0x942: 0x13e3, 0x943: 0x1413, 0x944: 0x144b, 0x945: 0x146b, + 0x946: 0x14b7, 0x947: 0x14db, 0x948: 0x14fb, 0x949: 0x150f, 0x94a: 0x151f, 0x94b: 0x152b, + 0x94c: 0x1537, 0x94d: 0x158b, 0x94e: 0x162b, 0x94f: 0x16b5, 0x950: 0x16b0, 0x951: 0x16e2, + 0x952: 0x0607, 0x953: 0x062f, 0x954: 0x0633, 0x955: 0x1764, 0x956: 0x1791, 0x957: 0x1809, + 0x958: 0x1617, 0x959: 0x1627, + // Block 0x26, offset 0x980 + 0x980: 0x06fb, 0x981: 0x06f3, 0x982: 0x0703, 0x983: 0x1647, 0x984: 0x0747, 0x985: 0x0757, + 0x986: 0x075b, 0x987: 0x0763, 0x988: 0x076b, 0x989: 0x076f, 0x98a: 0x077b, 0x98b: 0x0773, + 0x98c: 0x05b3, 0x98d: 0x165b, 0x98e: 0x078f, 0x98f: 0x0793, 0x990: 0x0797, 0x991: 0x07b3, + 0x992: 0x164c, 0x993: 0x05b7, 0x994: 0x079f, 0x995: 0x07bf, 0x996: 0x1656, 0x997: 0x07cf, + 0x998: 0x07d7, 0x999: 0x0737, 0x99a: 0x07df, 0x99b: 0x07e3, 0x99c: 0x1831, 0x99d: 0x07ff, + 0x99e: 0x0807, 0x99f: 0x05bf, 0x9a0: 0x081f, 0x9a1: 0x0823, 0x9a2: 0x082b, 0x9a3: 0x082f, + 0x9a4: 0x05c3, 0x9a5: 0x0847, 0x9a6: 0x084b, 0x9a7: 0x0857, 0x9a8: 0x0863, 0x9a9: 0x0867, + 0x9aa: 0x086b, 0x9ab: 0x0873, 0x9ac: 0x0893, 0x9ad: 0x0897, 0x9ae: 0x089f, 0x9af: 0x08af, + 0x9b0: 0x08b7, 0x9b1: 0x08bb, 0x9b2: 0x08bb, 0x9b3: 0x08bb, 0x9b4: 0x166a, 0x9b5: 0x0e93, + 0x9b6: 0x08cf, 0x9b7: 0x08d7, 0x9b8: 0x166f, 0x9b9: 0x08e3, 0x9ba: 0x08eb, 0x9bb: 0x08f3, + 0x9bc: 0x091b, 0x9bd: 0x0907, 0x9be: 0x0913, 0x9bf: 0x0917, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x091f, 0x9c1: 0x0927, 0x9c2: 0x092b, 0x9c3: 0x0933, 0x9c4: 0x093b, 0x9c5: 0x093f, + 0x9c6: 0x093f, 0x9c7: 0x0947, 0x9c8: 0x094f, 0x9c9: 0x0953, 0x9ca: 0x095f, 0x9cb: 0x0983, + 0x9cc: 0x0967, 0x9cd: 0x0987, 0x9ce: 0x096b, 0x9cf: 0x0973, 0x9d0: 0x080b, 0x9d1: 0x09cf, + 0x9d2: 0x0997, 0x9d3: 0x099b, 0x9d4: 0x099f, 0x9d5: 0x0993, 0x9d6: 0x09a7, 0x9d7: 0x09a3, + 0x9d8: 0x09bb, 0x9d9: 0x1674, 0x9da: 0x09d7, 0x9db: 0x09db, 0x9dc: 0x09e3, 0x9dd: 0x09ef, + 0x9de: 0x09f7, 0x9df: 0x0a13, 0x9e0: 0x1679, 0x9e1: 0x167e, 0x9e2: 0x0a1f, 0x9e3: 0x0a23, + 0x9e4: 0x0a27, 0x9e5: 0x0a1b, 0x9e6: 0x0a2f, 0x9e7: 0x05c7, 0x9e8: 0x05cb, 0x9e9: 0x0a37, + 0x9ea: 0x0a3f, 0x9eb: 0x0a3f, 0x9ec: 0x1683, 0x9ed: 0x0a5b, 0x9ee: 0x0a5f, 0x9ef: 0x0a63, + 0x9f0: 0x0a6b, 0x9f1: 0x1688, 0x9f2: 0x0a73, 0x9f3: 0x0a77, 0x9f4: 0x0b4f, 0x9f5: 0x0a7f, + 0x9f6: 0x05cf, 0x9f7: 0x0a8b, 0x9f8: 0x0a9b, 0x9f9: 0x0aa7, 0x9fa: 0x0aa3, 0x9fb: 0x1692, + 0x9fc: 0x0aaf, 0x9fd: 0x1697, 0x9fe: 0x0abb, 0x9ff: 0x0ab7, + // Block 0x28, offset 0xa00 + 0xa00: 0x0abf, 0xa01: 0x0acf, 0xa02: 0x0ad3, 0xa03: 0x05d3, 0xa04: 0x0ae3, 0xa05: 0x0aeb, + 0xa06: 0x0aef, 0xa07: 0x0af3, 0xa08: 0x05d7, 0xa09: 0x169c, 0xa0a: 0x05db, 0xa0b: 0x0b0f, + 0xa0c: 0x0b13, 0xa0d: 0x0b17, 0xa0e: 0x0b1f, 0xa0f: 0x1863, 0xa10: 0x0b37, 0xa11: 0x16a6, + 0xa12: 0x16a6, 0xa13: 0x11d7, 0xa14: 0x0b47, 0xa15: 0x0b47, 0xa16: 0x05df, 0xa17: 0x16c9, + 0xa18: 0x179b, 0xa19: 0x0b57, 0xa1a: 0x0b5f, 0xa1b: 0x05e3, 0xa1c: 0x0b73, 0xa1d: 0x0b83, + 0xa1e: 0x0b87, 0xa1f: 0x0b8f, 0xa20: 0x0b9f, 0xa21: 0x05eb, 0xa22: 0x05e7, 0xa23: 0x0ba3, + 0xa24: 0x16ab, 0xa25: 0x0ba7, 0xa26: 0x0bbb, 0xa27: 0x0bbf, 0xa28: 0x0bc3, 0xa29: 0x0bbf, + 0xa2a: 0x0bcf, 0xa2b: 0x0bd3, 0xa2c: 0x0be3, 0xa2d: 0x0bdb, 0xa2e: 0x0bdf, 0xa2f: 0x0be7, + 0xa30: 0x0beb, 0xa31: 0x0bef, 0xa32: 0x0bfb, 0xa33: 0x0bff, 0xa34: 0x0c17, 0xa35: 0x0c1f, + 0xa36: 0x0c2f, 0xa37: 0x0c43, 0xa38: 0x16ba, 0xa39: 0x0c3f, 0xa3a: 0x0c33, 0xa3b: 0x0c4b, + 0xa3c: 0x0c53, 0xa3d: 0x0c67, 0xa3e: 0x16bf, 0xa3f: 0x0c6f, + // Block 0x29, offset 0xa40 + 0xa40: 0x0c63, 0xa41: 0x0c5b, 0xa42: 0x05ef, 0xa43: 0x0c77, 0xa44: 0x0c7f, 0xa45: 0x0c87, + 0xa46: 0x0c7b, 0xa47: 0x05f3, 0xa48: 0x0c97, 0xa49: 0x0c9f, 0xa4a: 0x16c4, 0xa4b: 0x0ccb, + 0xa4c: 0x0cff, 0xa4d: 0x0cdb, 0xa4e: 0x05ff, 0xa4f: 0x0ce7, 0xa50: 0x05fb, 0xa51: 0x05f7, + 0xa52: 0x07c3, 0xa53: 0x07c7, 0xa54: 0x0d03, 0xa55: 0x0ceb, 0xa56: 0x11ab, 0xa57: 0x0663, + 0xa58: 0x0d0f, 0xa59: 0x0d13, 0xa5a: 0x0d17, 0xa5b: 0x0d2b, 0xa5c: 0x0d23, 0xa5d: 0x16dd, + 0xa5e: 0x0603, 0xa5f: 0x0d3f, 0xa60: 0x0d33, 0xa61: 0x0d4f, 0xa62: 0x0d57, 0xa63: 0x16e7, + 0xa64: 0x0d5b, 0xa65: 0x0d47, 0xa66: 0x0d63, 0xa67: 0x0607, 0xa68: 0x0d67, 0xa69: 0x0d6b, + 0xa6a: 0x0d6f, 0xa6b: 0x0d7b, 0xa6c: 0x16ec, 0xa6d: 0x0d83, 0xa6e: 0x060b, 0xa6f: 0x0d8f, + 0xa70: 0x16f1, 0xa71: 0x0d93, 0xa72: 0x060f, 0xa73: 0x0d9f, 0xa74: 0x0dab, 0xa75: 0x0db7, + 0xa76: 0x0dbb, 0xa77: 0x16f6, 0xa78: 0x168d, 0xa79: 0x16fb, 0xa7a: 0x0ddb, 0xa7b: 0x1700, + 0xa7c: 0x0de7, 0xa7d: 0x0def, 0xa7e: 0x0ddf, 0xa7f: 0x0dfb, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0e0b, 0xa81: 0x0e1b, 0xa82: 0x0e0f, 0xa83: 0x0e13, 0xa84: 0x0e1f, 0xa85: 0x0e23, + 0xa86: 0x1705, 0xa87: 0x0e07, 0xa88: 0x0e3b, 0xa89: 0x0e3f, 0xa8a: 0x0613, 0xa8b: 0x0e53, + 0xa8c: 0x0e4f, 0xa8d: 0x170a, 0xa8e: 0x0e33, 0xa8f: 0x0e6f, 0xa90: 0x170f, 0xa91: 0x1714, + 0xa92: 0x0e73, 0xa93: 0x0e87, 0xa94: 0x0e83, 0xa95: 0x0e7f, 0xa96: 0x0617, 0xa97: 0x0e8b, + 0xa98: 0x0e9b, 0xa99: 0x0e97, 0xa9a: 0x0ea3, 0xa9b: 0x1651, 0xa9c: 0x0eb3, 0xa9d: 0x1719, + 0xa9e: 0x0ebf, 0xa9f: 0x1723, 0xaa0: 0x0ed3, 0xaa1: 0x0edf, 0xaa2: 0x0ef3, 0xaa3: 0x1728, + 0xaa4: 0x0f07, 0xaa5: 0x0f0b, 0xaa6: 0x172d, 0xaa7: 0x1732, 0xaa8: 0x0f27, 0xaa9: 0x0f37, + 0xaaa: 0x061b, 0xaab: 0x0f3b, 0xaac: 0x061f, 0xaad: 0x061f, 0xaae: 0x0f53, 0xaaf: 0x0f57, + 0xab0: 0x0f5f, 0xab1: 0x0f63, 0xab2: 0x0f6f, 0xab3: 0x0623, 0xab4: 0x0f87, 0xab5: 0x1737, + 0xab6: 0x0fa3, 0xab7: 0x173c, 0xab8: 0x0faf, 0xab9: 0x16a1, 0xaba: 0x0fbf, 0xabb: 0x1741, + 0xabc: 0x1746, 0xabd: 0x174b, 0xabe: 0x0627, 0xabf: 0x062b, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0ff7, 0xac1: 0x1755, 0xac2: 0x1750, 0xac3: 0x175a, 0xac4: 0x175f, 0xac5: 0x0fff, + 0xac6: 0x1003, 0xac7: 0x1003, 0xac8: 0x100b, 0xac9: 0x0633, 0xaca: 0x100f, 0xacb: 0x0637, + 0xacc: 0x063b, 0xacd: 0x1769, 0xace: 0x1023, 0xacf: 0x102b, 0xad0: 0x1037, 0xad1: 0x063f, + 0xad2: 0x176e, 0xad3: 0x105b, 0xad4: 0x1773, 0xad5: 0x1778, 0xad6: 0x107b, 0xad7: 0x1093, + 0xad8: 0x0643, 0xad9: 0x109b, 0xada: 0x109f, 0xadb: 0x10a3, 0xadc: 0x177d, 0xadd: 0x1782, + 0xade: 0x1782, 0xadf: 0x10bb, 0xae0: 0x0647, 0xae1: 0x1787, 0xae2: 0x10cf, 0xae3: 0x10d3, + 0xae4: 0x064b, 0xae5: 0x178c, 0xae6: 0x10ef, 0xae7: 0x064f, 0xae8: 0x10ff, 0xae9: 0x10f7, + 0xaea: 0x1107, 0xaeb: 0x1796, 0xaec: 0x111f, 0xaed: 0x0653, 0xaee: 0x112b, 0xaef: 0x1133, + 0xaf0: 0x1143, 0xaf1: 0x0657, 0xaf2: 0x17a0, 0xaf3: 0x17a5, 0xaf4: 0x065b, 0xaf5: 0x17aa, + 0xaf6: 0x115b, 0xaf7: 0x17af, 0xaf8: 0x1167, 0xaf9: 0x1173, 0xafa: 0x117b, 0xafb: 0x17b4, + 0xafc: 0x17b9, 0xafd: 0x118f, 0xafe: 0x17be, 0xaff: 0x1197, + // Block 0x2c, offset 0xb00 + 0xb00: 0x16ce, 0xb01: 0x065f, 0xb02: 0x11af, 0xb03: 0x11b3, 0xb04: 0x0667, 0xb05: 0x11b7, + 0xb06: 0x0a33, 0xb07: 0x17c3, 0xb08: 0x17c8, 0xb09: 0x16d3, 0xb0a: 0x16d8, 0xb0b: 0x11d7, + 0xb0c: 0x11db, 0xb0d: 0x13f3, 0xb0e: 0x066b, 0xb0f: 0x1207, 0xb10: 0x1203, 0xb11: 0x120b, + 0xb12: 0x083f, 0xb13: 0x120f, 0xb14: 0x1213, 0xb15: 0x1217, 0xb16: 0x121f, 0xb17: 0x17cd, + 0xb18: 0x121b, 0xb19: 0x1223, 0xb1a: 0x1237, 0xb1b: 0x123b, 0xb1c: 0x1227, 0xb1d: 0x123f, + 0xb1e: 0x1253, 0xb1f: 0x1267, 0xb20: 0x1233, 0xb21: 0x1247, 0xb22: 0x124b, 0xb23: 0x124f, + 0xb24: 0x17d2, 0xb25: 0x17dc, 0xb26: 0x17d7, 0xb27: 0x066f, 0xb28: 0x126f, 0xb29: 0x1273, + 0xb2a: 0x127b, 0xb2b: 0x17f0, 0xb2c: 0x127f, 0xb2d: 0x17e1, 0xb2e: 0x0673, 0xb2f: 0x0677, + 0xb30: 0x17e6, 0xb31: 0x17eb, 0xb32: 0x067b, 0xb33: 0x129f, 0xb34: 0x12a3, 0xb35: 0x12a7, + 0xb36: 0x12ab, 0xb37: 0x12b7, 0xb38: 0x12b3, 0xb39: 0x12bf, 0xb3a: 0x12bb, 0xb3b: 0x12cb, + 0xb3c: 0x12c3, 0xb3d: 0x12c7, 0xb3e: 0x12cf, 0xb3f: 0x067f, + // Block 0x2d, offset 0xb40 + 0xb40: 0x12d7, 0xb41: 0x12db, 0xb42: 0x0683, 0xb43: 0x12eb, 0xb44: 0x12ef, 0xb45: 0x17f5, + 0xb46: 0x12fb, 0xb47: 0x12ff, 0xb48: 0x0687, 0xb49: 0x130b, 0xb4a: 0x05bb, 0xb4b: 0x17fa, + 0xb4c: 0x17ff, 0xb4d: 0x068b, 0xb4e: 0x068f, 0xb4f: 0x1337, 0xb50: 0x134f, 0xb51: 0x136b, + 0xb52: 0x137b, 0xb53: 0x1804, 0xb54: 0x138f, 0xb55: 0x1393, 0xb56: 0x13ab, 0xb57: 0x13b7, + 0xb58: 0x180e, 0xb59: 0x1660, 0xb5a: 0x13c3, 0xb5b: 0x13bf, 0xb5c: 0x13cb, 0xb5d: 0x1665, + 0xb5e: 0x13d7, 0xb5f: 0x13e3, 0xb60: 0x1813, 0xb61: 0x1818, 0xb62: 0x1423, 0xb63: 0x142f, + 0xb64: 0x1437, 0xb65: 0x181d, 0xb66: 0x143b, 0xb67: 0x1467, 0xb68: 0x1473, 0xb69: 0x1477, + 0xb6a: 0x146f, 0xb6b: 0x1483, 0xb6c: 0x1487, 0xb6d: 0x1822, 0xb6e: 0x1493, 0xb6f: 0x0693, + 0xb70: 0x149b, 0xb71: 0x1827, 0xb72: 0x0697, 0xb73: 0x14d3, 0xb74: 0x0ac3, 0xb75: 0x14eb, + 0xb76: 0x182c, 0xb77: 0x1836, 0xb78: 0x069b, 0xb79: 0x069f, 0xb7a: 0x1513, 0xb7b: 0x183b, + 0xb7c: 0x06a3, 0xb7d: 0x1840, 0xb7e: 0x152b, 0xb7f: 0x152b, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1533, 0xb81: 0x1845, 0xb82: 0x154b, 0xb83: 0x06a7, 0xb84: 0x155b, 0xb85: 0x1567, + 0xb86: 0x156f, 0xb87: 0x1577, 0xb88: 0x06ab, 0xb89: 0x184a, 0xb8a: 0x158b, 0xb8b: 0x15a7, + 0xb8c: 0x15b3, 0xb8d: 0x06af, 0xb8e: 0x06b3, 0xb8f: 0x15b7, 0xb90: 0x184f, 0xb91: 0x06b7, + 0xb92: 0x1854, 0xb93: 0x1859, 0xb94: 0x185e, 0xb95: 0x15db, 0xb96: 0x06bb, 0xb97: 0x15ef, + 0xb98: 0x15f7, 0xb99: 0x15fb, 0xb9a: 0x1603, 0xb9b: 0x160b, 0xb9c: 0x1613, 0xb9d: 0x1868, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2d, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2e, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x2f, 0xcb: 0x30, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x31, + 0xd0: 0x09, 0xd1: 0x32, 0xd2: 0x33, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x34, + 0xd8: 0x35, 0xd9: 0x0c, 0xdb: 0x36, 0xdc: 0x37, 0xdd: 0x38, 0xdf: 0x39, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3a, 0x121: 0x3b, 0x123: 0x3c, 0x124: 0x3d, 0x125: 0x3e, 0x126: 0x3f, 0x127: 0x40, + 0x128: 0x41, 0x129: 0x42, 0x12a: 0x43, 0x12b: 0x44, 0x12c: 0x3f, 0x12d: 0x45, 0x12e: 0x46, 0x12f: 0x47, + 0x131: 0x48, 0x132: 0x49, 0x133: 0x4a, 0x134: 0x4b, 0x135: 0x4c, 0x137: 0x4d, + 0x138: 0x4e, 0x139: 0x4f, 0x13a: 0x50, 0x13b: 0x51, 0x13c: 0x52, 0x13d: 0x53, 0x13e: 0x54, 0x13f: 0x55, + // Block 0x5, offset 0x140 + 0x140: 0x56, 0x142: 0x57, 0x144: 0x58, 0x145: 0x59, 0x146: 0x5a, 0x147: 0x5b, + 0x14d: 0x5c, + 0x15c: 0x5d, 0x15f: 0x5e, + 0x162: 0x5f, 0x164: 0x60, + 0x168: 0x61, 0x169: 0x62, 0x16a: 0x63, 0x16c: 0x0d, 0x16d: 0x64, 0x16e: 0x65, 0x16f: 0x66, + 0x170: 0x67, 0x173: 0x68, 0x177: 0x0e, + 0x178: 0x0f, 0x179: 0x10, 0x17a: 0x11, 0x17b: 0x12, 0x17c: 0x13, 0x17d: 0x14, 0x17e: 0x15, 0x17f: 0x16, + // Block 0x6, offset 0x180 + 0x180: 0x69, 0x183: 0x6a, 0x184: 0x6b, 0x186: 0x6c, 0x187: 0x6d, + 0x188: 0x6e, 0x189: 0x17, 0x18a: 0x18, 0x18b: 0x6f, 0x18c: 0x70, + 0x1ab: 0x71, + 0x1b3: 0x72, 0x1b5: 0x73, 0x1b7: 0x74, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x75, 0x1c1: 0x19, 0x1c2: 0x1a, 0x1c3: 0x1b, 0x1c4: 0x76, 0x1c5: 0x77, + 0x1c9: 0x78, 0x1cc: 0x79, 0x1cd: 0x7a, + // Block 0x8, offset 0x200 + 0x219: 0x7b, 0x21a: 0x7c, 0x21b: 0x7d, + 0x220: 0x7e, 0x223: 0x7f, 0x224: 0x80, 0x225: 0x81, 0x226: 0x82, 0x227: 0x83, + 0x22a: 0x84, 0x22b: 0x85, 0x22f: 0x86, + 0x230: 0x87, 0x231: 0x88, 0x232: 0x89, 0x233: 0x8a, 0x234: 0x8b, 0x235: 0x8c, 0x236: 0x8d, 0x237: 0x87, + 0x238: 0x88, 0x239: 0x89, 0x23a: 0x8a, 0x23b: 0x8b, 0x23c: 0x8c, 0x23d: 0x8d, 0x23e: 0x87, 0x23f: 0x88, + // Block 0x9, offset 0x240 + 0x240: 0x89, 0x241: 0x8a, 0x242: 0x8b, 0x243: 0x8c, 0x244: 0x8d, 0x245: 0x87, 0x246: 0x88, 0x247: 0x89, + 0x248: 0x8a, 0x249: 0x8b, 0x24a: 0x8c, 0x24b: 0x8d, 0x24c: 0x87, 0x24d: 0x88, 0x24e: 0x89, 0x24f: 0x8a, + 0x250: 0x8b, 0x251: 0x8c, 0x252: 0x8d, 0x253: 0x87, 0x254: 0x88, 0x255: 0x89, 0x256: 0x8a, 0x257: 0x8b, + 0x258: 0x8c, 0x259: 0x8d, 0x25a: 0x87, 0x25b: 0x88, 0x25c: 0x89, 0x25d: 0x8a, 0x25e: 0x8b, 0x25f: 0x8c, + 0x260: 0x8d, 0x261: 0x87, 0x262: 0x88, 0x263: 0x89, 0x264: 0x8a, 0x265: 0x8b, 0x266: 0x8c, 0x267: 0x8d, + 0x268: 0x87, 0x269: 0x88, 0x26a: 0x89, 0x26b: 0x8a, 0x26c: 0x8b, 0x26d: 0x8c, 0x26e: 0x8d, 0x26f: 0x87, + 0x270: 0x88, 0x271: 0x89, 0x272: 0x8a, 0x273: 0x8b, 0x274: 0x8c, 0x275: 0x8d, 0x276: 0x87, 0x277: 0x88, + 0x278: 0x89, 0x279: 0x8a, 0x27a: 0x8b, 0x27b: 0x8c, 0x27c: 0x8d, 0x27d: 0x87, 0x27e: 0x88, 0x27f: 0x89, + // Block 0xa, offset 0x280 + 0x280: 0x8a, 0x281: 0x8b, 0x282: 0x8c, 0x283: 0x8d, 0x284: 0x87, 0x285: 0x88, 0x286: 0x89, 0x287: 0x8a, + 0x288: 0x8b, 0x289: 0x8c, 0x28a: 0x8d, 0x28b: 0x87, 0x28c: 0x88, 0x28d: 0x89, 0x28e: 0x8a, 0x28f: 0x8b, + 0x290: 0x8c, 0x291: 0x8d, 0x292: 0x87, 0x293: 0x88, 0x294: 0x89, 0x295: 0x8a, 0x296: 0x8b, 0x297: 0x8c, + 0x298: 0x8d, 0x299: 0x87, 0x29a: 0x88, 0x29b: 0x89, 0x29c: 0x8a, 0x29d: 0x8b, 0x29e: 0x8c, 0x29f: 0x8d, + 0x2a0: 0x87, 0x2a1: 0x88, 0x2a2: 0x89, 0x2a3: 0x8a, 0x2a4: 0x8b, 0x2a5: 0x8c, 0x2a6: 0x8d, 0x2a7: 0x87, + 0x2a8: 0x88, 0x2a9: 0x89, 0x2aa: 0x8a, 0x2ab: 0x8b, 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x87, 0x2af: 0x88, + 0x2b0: 0x89, 0x2b1: 0x8a, 0x2b2: 0x8b, 0x2b3: 0x8c, 0x2b4: 0x8d, 0x2b5: 0x87, 0x2b6: 0x88, 0x2b7: 0x89, + 0x2b8: 0x8a, 0x2b9: 0x8b, 0x2ba: 0x8c, 0x2bb: 0x8d, 0x2bc: 0x87, 0x2bd: 0x88, 0x2be: 0x89, 0x2bf: 0x8a, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8b, 0x2c1: 0x8c, 0x2c2: 0x8d, 0x2c3: 0x87, 0x2c4: 0x88, 0x2c5: 0x89, 0x2c6: 0x8a, 0x2c7: 0x8b, + 0x2c8: 0x8c, 0x2c9: 0x8d, 0x2ca: 0x87, 0x2cb: 0x88, 0x2cc: 0x89, 0x2cd: 0x8a, 0x2ce: 0x8b, 0x2cf: 0x8c, + 0x2d0: 0x8d, 0x2d1: 0x87, 0x2d2: 0x88, 0x2d3: 0x89, 0x2d4: 0x8a, 0x2d5: 0x8b, 0x2d6: 0x8c, 0x2d7: 0x8d, + 0x2d8: 0x87, 0x2d9: 0x88, 0x2da: 0x89, 0x2db: 0x8a, 0x2dc: 0x8b, 0x2dd: 0x8c, 0x2de: 0x8e, + // Block 0xc, offset 0x300 + 0x324: 0x1c, 0x325: 0x1d, 0x326: 0x1e, 0x327: 0x1f, + 0x328: 0x20, 0x329: 0x21, 0x32a: 0x22, 0x32b: 0x23, 0x32c: 0x8f, 0x32d: 0x90, 0x32e: 0x91, + 0x331: 0x92, 0x332: 0x93, 0x333: 0x94, 0x334: 0x95, + 0x338: 0x96, 0x339: 0x97, 0x33a: 0x98, 0x33b: 0x99, 0x33e: 0x9a, 0x33f: 0x9b, + // Block 0xd, offset 0x340 + 0x347: 0x9c, + 0x34b: 0x9d, 0x34d: 0x9e, + 0x368: 0x9f, 0x36b: 0xa0, + // Block 0xe, offset 0x380 + 0x381: 0xa1, 0x382: 0xa2, 0x384: 0xa3, 0x385: 0x82, 0x387: 0xa4, + 0x388: 0xa5, 0x38b: 0xa6, 0x38c: 0x3f, 0x38d: 0xa7, + 0x391: 0xa8, 0x392: 0xa9, 0x393: 0xaa, 0x396: 0xab, 0x397: 0xac, + 0x398: 0x73, 0x39a: 0xad, 0x39c: 0xae, + 0x3a8: 0xaf, 0x3a9: 0xb0, 0x3aa: 0xb1, + 0x3b0: 0x73, 0x3b5: 0xb2, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xb3, 0x3ec: 0xb4, + // Block 0x10, offset 0x400 + 0x432: 0xb5, + // Block 0x11, offset 0x440 + 0x445: 0xb6, 0x446: 0xb7, 0x447: 0xb8, + 0x449: 0xb9, + // Block 0x12, offset 0x480 + 0x480: 0xba, + 0x4a3: 0xbb, 0x4a5: 0xbc, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xbd, + // Block 0x14, offset 0x500 + 0x520: 0x24, 0x521: 0x25, 0x522: 0x26, 0x523: 0x27, 0x524: 0x28, 0x525: 0x29, 0x526: 0x2a, 0x527: 0x2b, + 0x528: 0x2c, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 145 entries, 290 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x62, 0x67, 0x69, 0x7a, 0x82, 0x89, 0x8c, 0x93, 0x97, 0x9b, 0x9d, 0x9f, 0xa8, 0xac, 0xb3, 0xb8, 0xbb, 0xc5, 0xc8, 0xcf, 0xd7, 0xda, 0xdc, 0xde, 0xe0, 0xe5, 0xf6, 0x102, 0x104, 0x10a, 0x10c, 0x10e, 0x110, 0x112, 0x114, 0x116, 0x119, 0x11c, 0x11e, 0x121, 0x124, 0x128, 0x12d, 0x136, 0x138, 0x13b, 0x13d, 0x148, 0x14c, 0x15a, 0x15d, 0x163, 0x169, 0x174, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x182, 0x188, 0x18c, 0x18e, 0x190, 0x198, 0x19c, 0x19f, 0x1a1, 0x1a3, 0x1a5, 0x1a8, 0x1aa, 0x1ac, 0x1ae, 0x1b0, 0x1b6, 0x1b9, 0x1bb, 0x1c2, 0x1c8, 0x1ce, 0x1d6, 0x1dc, 0x1e2, 0x1e8, 0x1ec, 0x1fa, 0x203, 0x206, 0x209, 0x20b, 0x20e, 0x210, 0x214, 0x219, 0x21b, 0x21d, 0x222, 0x228, 0x22a, 0x22c, 0x22e, 0x234, 0x237, 0x23a, 0x242, 0x249, 0x24c, 0x24f, 0x251, 0x259, 0x25c, 0x263, 0x266, 0x26c, 0x26e, 0x271, 0x273, 0x275, 0x277, 0x279, 0x27c, 0x27e, 0x280, 0x282, 0x28f, 0x299, 0x29b, 0x29d, 0x2a3, 0x2a5, 0x2a8} + +// nfcSparseValues: 682 entries, 2728 bytes +var nfcSparseValues = [682]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4840, lo: 0x8a, hi: 0x8a}, + {value: 0x485e, lo: 0x8b, hi: 0x8b}, + {value: 0x36c7, lo: 0x8c, hi: 0x8c}, + {value: 0x36df, lo: 0x8d, hi: 0x8d}, + {value: 0x4876, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x36fd, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x37a5, lo: 0x90, hi: 0x90}, + {value: 0x37b1, lo: 0x91, hi: 0x91}, + {value: 0x379f, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3817, lo: 0x97, hi: 0x97}, + {value: 0x37e1, lo: 0x9c, hi: 0x9c}, + {value: 0x37c9, lo: 0x9d, hi: 0x9d}, + {value: 0x37f3, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x381d, lo: 0xb6, hi: 0xb6}, + {value: 0x3823, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8113, lo: 0x81, hi: 0x82}, + {value: 0x8132, lo: 0x84, hi: 0x84}, + {value: 0x812d, lo: 0x85, hi: 0x85}, + {value: 0x810d, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x97}, + {value: 0x8119, lo: 0x98, hi: 0x98}, + {value: 0x811a, lo: 0x99, hi: 0x99}, + {value: 0x811b, lo: 0x9a, hi: 0x9a}, + {value: 0x3841, lo: 0xa2, hi: 0xa2}, + {value: 0x3847, lo: 0xa3, hi: 0xa3}, + {value: 0x3853, lo: 0xa4, hi: 0xa4}, + {value: 0x384d, lo: 0xa5, hi: 0xa5}, + {value: 0x3859, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x386b, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x385f, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x3865, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8132, lo: 0x96, hi: 0x9c}, + {value: 0x8132, lo: 0x9f, hi: 0xa2}, + {value: 0x812d, lo: 0xa3, hi: 0xa3}, + {value: 0x8132, lo: 0xa4, hi: 0xa4}, + {value: 0x8132, lo: 0xa7, hi: 0xa8}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xac}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x811f, lo: 0x91, hi: 0x91}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x812d, lo: 0xb1, hi: 0xb1}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb5, hi: 0xb6}, + {value: 0x812d, lo: 0xb7, hi: 0xb9}, + {value: 0x8132, lo: 0xba, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbc}, + {value: 0x8132, lo: 0xbd, hi: 0xbd}, + {value: 0x812d, lo: 0xbe, hi: 0xbe}, + {value: 0x8132, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8132, lo: 0x80, hi: 0x80}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x812d, lo: 0x82, hi: 0x83}, + {value: 0x812d, lo: 0x84, hi: 0x85}, + {value: 0x812d, lo: 0x86, hi: 0x87}, + {value: 0x812d, lo: 0x88, hi: 0x89}, + {value: 0x8132, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x03}, + {value: 0x8132, lo: 0xab, hi: 0xb1}, + {value: 0x812d, lo: 0xb2, hi: 0xb2}, + {value: 0x8132, lo: 0xb3, hi: 0xb3}, + // Block 0xd, offset 0x62 + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0x96, hi: 0x99}, + {value: 0x8132, lo: 0x9b, hi: 0xa3}, + {value: 0x8132, lo: 0xa5, hi: 0xa7}, + {value: 0x8132, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x67 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x69 + {value: 0x0000, lo: 0x10}, + {value: 0x8132, lo: 0x94, hi: 0xa1}, + {value: 0x812d, lo: 0xa3, hi: 0xa3}, + {value: 0x8132, lo: 0xa4, hi: 0xa5}, + {value: 0x812d, lo: 0xa6, hi: 0xa6}, + {value: 0x8132, lo: 0xa7, hi: 0xa8}, + {value: 0x812d, lo: 0xa9, hi: 0xa9}, + {value: 0x8132, lo: 0xaa, hi: 0xac}, + {value: 0x812d, lo: 0xad, hi: 0xaf}, + {value: 0x8116, lo: 0xb0, hi: 0xb0}, + {value: 0x8117, lo: 0xb1, hi: 0xb1}, + {value: 0x8118, lo: 0xb2, hi: 0xb2}, + {value: 0x8132, lo: 0xb3, hi: 0xb5}, + {value: 0x812d, lo: 0xb6, hi: 0xb6}, + {value: 0x8132, lo: 0xb7, hi: 0xb8}, + {value: 0x812d, lo: 0xb9, hi: 0xba}, + {value: 0x8132, lo: 0xbb, hi: 0xbf}, + // Block 0x10, offset 0x7a + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x3ed8, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x3ee0, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x3ee8, lo: 0xb4, hi: 0xb4}, + {value: 0x9902, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x82 + {value: 0x0008, lo: 0x06}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x91, hi: 0x91}, + {value: 0x812d, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x93, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x94}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x89 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x8c + {value: 0x0008, lo: 0x06}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, + // Block 0x14, offset 0x93 + {value: 0x0000, lo: 0x03}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x97 + {value: 0x0008, lo: 0x03}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x9b + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x9d + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x9f + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2cb6, lo: 0x88, hi: 0x88}, + {value: 0x2cae, lo: 0x8b, hi: 0x8b}, + {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0xa8 + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2cc6, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xac + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cce, lo: 0x8a, hi: 0x8a}, + {value: 0x2cde, lo: 0x8b, hi: 0x8b}, + {value: 0x2cd6, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xb3 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x3ef0, lo: 0x88, hi: 0x88}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8120, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xb8 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xbb + {value: 0x0000, lo: 0x09}, + {value: 0x2ce6, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2cee, lo: 0x87, hi: 0x87}, + {value: 0x2cf6, lo: 0x88, hi: 0x88}, + {value: 0x2f50, lo: 0x8a, hi: 0x8a}, + {value: 0x2dd8, lo: 0x8b, hi: 0x8b}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xc5 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xc8 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cfe, lo: 0x8a, hi: 0x8a}, + {value: 0x2d0e, lo: 0x8b, hi: 0x8b}, + {value: 0x2d06, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xcf + {value: 0x6bea, lo: 0x07}, + {value: 0x9904, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x3ef8, lo: 0x9a, hi: 0x9a}, + {value: 0x2f58, lo: 0x9c, hi: 0x9c}, + {value: 0x2de3, lo: 0x9d, hi: 0x9d}, + {value: 0x2d16, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xd7 + {value: 0x0000, lo: 0x02}, + {value: 0x8122, lo: 0xb8, hi: 0xb9}, + {value: 0x8104, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xda + {value: 0x0000, lo: 0x01}, + {value: 0x8123, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xdc + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0xb8, hi: 0xb9}, + // Block 0x24, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8125, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xe0 + {value: 0x0000, lo: 0x04}, + {value: 0x812d, lo: 0x98, hi: 0x99}, + {value: 0x812d, lo: 0xb5, hi: 0xb5}, + {value: 0x812d, lo: 0xb7, hi: 0xb7}, + {value: 0x812b, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xe5 + {value: 0x0000, lo: 0x10}, + {value: 0x2644, lo: 0x83, hi: 0x83}, + {value: 0x264b, lo: 0x8d, hi: 0x8d}, + {value: 0x2652, lo: 0x92, hi: 0x92}, + {value: 0x2659, lo: 0x97, hi: 0x97}, + {value: 0x2660, lo: 0x9c, hi: 0x9c}, + {value: 0x263d, lo: 0xa9, hi: 0xa9}, + {value: 0x8126, lo: 0xb1, hi: 0xb1}, + {value: 0x8127, lo: 0xb2, hi: 0xb2}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, + {value: 0x8128, lo: 0xb4, hi: 0xb4}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8127, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xf6 + {value: 0x0000, lo: 0x0b}, + {value: 0x8127, lo: 0x80, hi: 0x80}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, + {value: 0x8132, lo: 0x82, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0x86, hi: 0x87}, + {value: 0x266e, lo: 0x93, hi: 0x93}, + {value: 0x2675, lo: 0x9d, hi: 0x9d}, + {value: 0x267c, lo: 0xa2, hi: 0xa2}, + {value: 0x2683, lo: 0xa7, hi: 0xa7}, + {value: 0x268a, lo: 0xac, hi: 0xac}, + {value: 0x2667, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0x104 + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2d1e, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x10c + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x10e + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x110 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x114 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x116 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x94, hi: 0x94}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x119 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x11c + {value: 0x0000, lo: 0x01}, + {value: 0x8131, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x11e + {value: 0x0004, lo: 0x02}, + {value: 0x812e, lo: 0xb9, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x97, hi: 0x97}, + {value: 0x812d, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x124 + {value: 0x0000, lo: 0x03}, + {value: 0x8104, lo: 0xa0, hi: 0xa0}, + {value: 0x8132, lo: 0xb5, hi: 0xbc}, + {value: 0x812d, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x128 + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + {value: 0x812d, lo: 0xb5, hi: 0xba}, + {value: 0x8132, lo: 0xbb, hi: 0xbc}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x37, offset 0x12d + {value: 0x0000, lo: 0x08}, + {value: 0x2d66, lo: 0x80, hi: 0x80}, + {value: 0x2d6e, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2d76, lo: 0x83, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xac}, + {value: 0x8132, lo: 0xad, hi: 0xb3}, + // Block 0x38, offset 0x136 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xaa, hi: 0xab}, + // Block 0x39, offset 0x138 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xa6, hi: 0xa6}, + {value: 0x8104, lo: 0xb2, hi: 0xb3}, + // Block 0x3a, offset 0x13b + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x3b, offset 0x13d + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812d, lo: 0x95, hi: 0x99}, + {value: 0x8132, lo: 0x9a, hi: 0x9b}, + {value: 0x812d, lo: 0x9c, hi: 0x9f}, + {value: 0x8132, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + {value: 0x8132, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb8, hi: 0xb9}, + // Block 0x3c, offset 0x148 + {value: 0x0004, lo: 0x03}, + {value: 0x0433, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3d, offset 0x14c + {value: 0x0000, lo: 0x0d}, + {value: 0x8132, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8132, lo: 0x9b, hi: 0x9c}, + {value: 0x8132, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8132, lo: 0xa7, hi: 0xa7}, + {value: 0x812d, lo: 0xa8, hi: 0xa8}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xaf}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + // Block 0x3e, offset 0x15a + {value: 0x427b, lo: 0x02}, + {value: 0x01b8, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x3f, offset 0x15d + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3bb9, lo: 0x9a, hi: 0x9b}, + {value: 0x3bc7, lo: 0xae, hi: 0xae}, + // Block 0x40, offset 0x163 + {value: 0x000e, lo: 0x05}, + {value: 0x3bce, lo: 0x8d, hi: 0x8e}, + {value: 0x3bd5, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x41, offset 0x169 + {value: 0x6408, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3be3, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3bea, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3bf1, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3bf8, lo: 0xa4, hi: 0xa5}, + {value: 0x3bff, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x42, offset 0x174 + {value: 0x0007, lo: 0x03}, + {value: 0x3c68, lo: 0xa0, hi: 0xa1}, + {value: 0x3c92, lo: 0xa2, hi: 0xa3}, + {value: 0x3cbc, lo: 0xaa, hi: 0xad}, + // Block 0x43, offset 0x178 + {value: 0x0004, lo: 0x01}, + {value: 0x048b, lo: 0xa9, hi: 0xaa}, + // Block 0x44, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, + // Block 0x45, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xaf, hi: 0xb1}, + // Block 0x46, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x47, offset 0x180 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa0, hi: 0xbf}, + // Block 0x48, offset 0x182 + {value: 0x0000, lo: 0x05}, + {value: 0x812c, lo: 0xaa, hi: 0xaa}, + {value: 0x8131, lo: 0xab, hi: 0xab}, + {value: 0x8133, lo: 0xac, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x812f, lo: 0xae, hi: 0xaf}, + // Block 0x49, offset 0x188 + {value: 0x0000, lo: 0x03}, + {value: 0x4a9f, lo: 0xb3, hi: 0xb3}, + {value: 0x4a9f, lo: 0xb5, hi: 0xb6}, + {value: 0x4a9f, lo: 0xba, hi: 0xbf}, + // Block 0x4a, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x4a9f, lo: 0x8f, hi: 0xa3}, + // Block 0x4b, offset 0x18e + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4c, offset 0x190 + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x198 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4e, offset 0x19c + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xaf, hi: 0xaf}, + {value: 0x8132, lo: 0xb4, hi: 0xbd}, + // Block 0x4f, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x9e, hi: 0x9f}, + // Block 0x50, offset 0x1a1 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb1}, + // Block 0x51, offset 0x1a3 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + // Block 0x52, offset 0x1a5 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xa0, hi: 0xb1}, + // Block 0x53, offset 0x1a8 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xab, hi: 0xad}, + // Block 0x54, offset 0x1aa + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x93, hi: 0x93}, + // Block 0x55, offset 0x1ac + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb3, hi: 0xb3}, + // Block 0x56, offset 0x1ae + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + // Block 0x57, offset 0x1b0 + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb7, hi: 0xb8}, + {value: 0x8132, lo: 0xbe, hi: 0xbf}, + // Block 0x58, offset 0x1b6 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + // Block 0x59, offset 0x1b9 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xad, hi: 0xad}, + // Block 0x5a, offset 0x1bb + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5b, offset 0x1c2 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5c, offset 0x1c8 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5d, offset 0x1ce + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5e, offset 0x1d6 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x5f, offset 0x1dc + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x60, offset 0x1e2 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x61, offset 0x1e8 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x62, offset 0x1ec + {value: 0x0006, lo: 0x0d}, + {value: 0x4390, lo: 0x9d, hi: 0x9d}, + {value: 0x8115, lo: 0x9e, hi: 0x9e}, + {value: 0x4402, lo: 0x9f, hi: 0x9f}, + {value: 0x43f0, lo: 0xaa, hi: 0xab}, + {value: 0x44f4, lo: 0xac, hi: 0xac}, + {value: 0x44fc, lo: 0xad, hi: 0xad}, + {value: 0x4348, lo: 0xae, hi: 0xb1}, + {value: 0x4366, lo: 0xb2, hi: 0xb4}, + {value: 0x437e, lo: 0xb5, hi: 0xb6}, + {value: 0x438a, lo: 0xb8, hi: 0xb8}, + {value: 0x4396, lo: 0xb9, hi: 0xbb}, + {value: 0x43ae, lo: 0xbc, hi: 0xbc}, + {value: 0x43b4, lo: 0xbe, hi: 0xbe}, + // Block 0x63, offset 0x1fa + {value: 0x0006, lo: 0x08}, + {value: 0x43ba, lo: 0x80, hi: 0x81}, + {value: 0x43c6, lo: 0x83, hi: 0x84}, + {value: 0x43d8, lo: 0x86, hi: 0x89}, + {value: 0x43fc, lo: 0x8a, hi: 0x8a}, + {value: 0x4378, lo: 0x8b, hi: 0x8b}, + {value: 0x4360, lo: 0x8c, hi: 0x8c}, + {value: 0x43a8, lo: 0x8d, hi: 0x8d}, + {value: 0x43d2, lo: 0x8e, hi: 0x8e}, + // Block 0x64, offset 0x203 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x65, offset 0x206 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x66, offset 0x209 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x67, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x68, offset 0x20e + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x69, offset 0x210 + {value: 0x0000, lo: 0x03}, + {value: 0x8132, lo: 0xa0, hi: 0xa6}, + {value: 0x812d, lo: 0xa7, hi: 0xad}, + {value: 0x8132, lo: 0xae, hi: 0xaf}, + // Block 0x6a, offset 0x214 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6b, offset 0x219 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6c, offset 0x21b + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6d, offset 0x21d + {value: 0x0000, lo: 0x04}, + {value: 0x4a9f, lo: 0x9e, hi: 0x9f}, + {value: 0x4a9f, lo: 0xa3, hi: 0xa3}, + {value: 0x4a9f, lo: 0xa5, hi: 0xa6}, + {value: 0x4a9f, lo: 0xaa, hi: 0xaf}, + // Block 0x6e, offset 0x222 + {value: 0x0000, lo: 0x05}, + {value: 0x4a9f, lo: 0x82, hi: 0x87}, + {value: 0x4a9f, lo: 0x8a, hi: 0x8f}, + {value: 0x4a9f, lo: 0x92, hi: 0x97}, + {value: 0x4a9f, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x6f, offset 0x228 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x70, offset 0x22a + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xa0, hi: 0xa0}, + // Block 0x71, offset 0x22c + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb6, hi: 0xba}, + // Block 0x72, offset 0x22e + {value: 0x002c, lo: 0x05}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x8f, hi: 0x8f}, + {value: 0x8132, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x73, offset 0x234 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xa5, hi: 0xa5}, + {value: 0x812d, lo: 0xa6, hi: 0xa6}, + // Block 0x74, offset 0x237 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x75, offset 0x23a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4238, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4242, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x424c, lo: 0xab, hi: 0xab}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x76, offset 0x242 + {value: 0x0000, lo: 0x06}, + {value: 0x8132, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2d7e, lo: 0xae, hi: 0xae}, + {value: 0x2d88, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8104, lo: 0xb3, hi: 0xb4}, + // Block 0x77, offset 0x249 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x78, offset 0x24c + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb5, hi: 0xb5}, + {value: 0x8102, lo: 0xb6, hi: 0xb6}, + // Block 0x79, offset 0x24f + {value: 0x0002, lo: 0x01}, + {value: 0x8102, lo: 0xa9, hi: 0xaa}, + // Block 0x7a, offset 0x251 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2d92, lo: 0x8b, hi: 0x8b}, + {value: 0x2d9c, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8132, lo: 0xa6, hi: 0xac}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + // Block 0x7b, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x86, hi: 0x86}, + // Block 0x7c, offset 0x25c + {value: 0x6b5a, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2db0, lo: 0xbb, hi: 0xbb}, + {value: 0x2da6, lo: 0xbc, hi: 0xbd}, + {value: 0x2dba, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x263 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x83, hi: 0x83}, + // Block 0x7e, offset 0x266 + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2dc4, lo: 0xba, hi: 0xba}, + {value: 0x2dce, lo: 0xbb, hi: 0xbb}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x7f, offset 0x26c + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0x80, hi: 0x80}, + // Block 0x80, offset 0x26e + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x81, offset 0x271 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xab, hi: 0xab}, + // Block 0x82, offset 0x273 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x83, offset 0x275 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x87, hi: 0x87}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x99, hi: 0x99}, + // Block 0x85, offset 0x279 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0x82, hi: 0x82}, + {value: 0x8104, lo: 0x84, hi: 0x85}, + // Block 0x86, offset 0x27c + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x87, offset 0x27e + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb6}, + // Block 0x88, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x89, offset 0x282 + {value: 0x0000, lo: 0x0c}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, + {value: 0x812b, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8130, lo: 0xad, hi: 0xad}, + {value: 0x812b, lo: 0xae, hi: 0xb2}, + {value: 0x812d, lo: 0xbb, hi: 0xbf}, + // Block 0x8a, offset 0x28f + {value: 0x0000, lo: 0x09}, + {value: 0x812d, lo: 0x80, hi: 0x82}, + {value: 0x8132, lo: 0x85, hi: 0x89}, + {value: 0x812d, lo: 0x8a, hi: 0x8b}, + {value: 0x8132, lo: 0xaa, hi: 0xad}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, + // Block 0x8b, offset 0x299 + {value: 0x0000, lo: 0x01}, + {value: 0x467a, lo: 0x80, hi: 0x80}, + // Block 0x8c, offset 0x29b + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x82, hi: 0x84}, + // Block 0x8d, offset 0x29d + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0x80, hi: 0x86}, + {value: 0x8132, lo: 0x88, hi: 0x98}, + {value: 0x8132, lo: 0x9b, hi: 0xa1}, + {value: 0x8132, lo: 0xa3, hi: 0xa4}, + {value: 0x8132, lo: 0xa6, hi: 0xaa}, + // Block 0x8e, offset 0x2a3 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x90, hi: 0x96}, + // Block 0x8f, offset 0x2a5 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x84, hi: 0x89}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x90, offset 0x2a8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 17104 bytes (16.70 KiB). Checksum: d985061cf5307b35. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 91: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 91 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 93 blocks, 5952 entries, 11904 bytes +// The third block is the zero block. +var nfkcValues = [5952]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, + // Block 0x4, offset 0x100 + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, + 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, + 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, + 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, + 0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6, + 0x130: 0x308c, 0x132: 0x195d, 0x133: 0x19e7, 0x134: 0x30b4, 0x135: 0x33c0, + 0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc, + 0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8, 0x13f: 0x1bac, + // Block 0x5, offset 0x140 + 0x140: 0x1c34, 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, + 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, 0x149: 0x1c5c, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, + 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, + 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2dee, 0x185: 0x2df4, + 0x186: 0x2dfa, 0x187: 0x1972, 0x188: 0x1975, 0x189: 0x1a08, 0x18a: 0x1987, 0x18b: 0x198a, + 0x18c: 0x1a3e, 0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140, + 0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8, + 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, + 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, + 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1b0: 0x33c5, 0x1b1: 0x1942, 0x1b2: 0x1945, 0x1b3: 0x19cf, 0x1b4: 0x3028, 0x1b5: 0x3334, + 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, + 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316, + 0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac, + 0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479, + 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, + 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, + 0x1de: 0x305a, 0x1df: 0x3366, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, + 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, + // Block 0x8, offset 0x200 + 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, + 0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932, + 0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932, + 0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d, + 0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d, + 0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d, + 0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d, + 0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d, + 0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, + 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, + // Block 0x9, offset 0x240 + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, + 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, + 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, + 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, + 0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135, + 0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132, + 0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132, + 0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132, + 0x274: 0x0170, + 0x27a: 0x42a5, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x425a, 0x285: 0x447b, + 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625, + 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, + 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4840, 0x2cb: 0x485e, + 0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x4876, 0x2d0: 0x01be, 0x2d1: 0x01d0, + 0x2d2: 0x01ac, 0x2d3: 0x430c, 0x2d4: 0x4312, 0x2d5: 0x01fa, 0x2d6: 0x01e8, + 0x2f0: 0x01d6, 0x2f1: 0x01eb, 0x2f2: 0x01ee, 0x2f4: 0x0188, 0x2f5: 0x01c7, + 0x2f9: 0x01a6, + // Block 0xc, offset 0x300 + 0x300: 0x3721, 0x301: 0x372d, 0x303: 0x371b, + 0x306: 0xa000, 0x307: 0x3709, + 0x30c: 0x375d, 0x30d: 0x3745, 0x30e: 0x376f, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3751, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x37d5, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3733, 0x342: 0x37b7, + 0x350: 0x370f, 0x351: 0x3793, + 0x352: 0x3715, 0x353: 0x3799, 0x356: 0x3727, 0x357: 0x37ab, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x3829, 0x35b: 0x382f, 0x35c: 0x3739, 0x35d: 0x37bd, + 0x35e: 0x373f, 0x35f: 0x37c3, 0x362: 0x374b, 0x363: 0x37cf, + 0x364: 0x3757, 0x365: 0x37db, 0x366: 0x3763, 0x367: 0x37e7, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3835, 0x36b: 0x383b, 0x36c: 0x378d, 0x36d: 0x3811, 0x36e: 0x3769, 0x36f: 0x37ed, + 0x370: 0x3775, 0x371: 0x37f9, 0x372: 0x377b, 0x373: 0x37ff, 0x374: 0x3781, 0x375: 0x3805, + 0x378: 0x3787, 0x379: 0x380b, + // Block 0xe, offset 0x380 + 0x387: 0x1d61, + 0x391: 0x812d, + 0x392: 0x8132, 0x393: 0x8132, 0x394: 0x8132, 0x395: 0x8132, 0x396: 0x812d, 0x397: 0x8132, + 0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x812e, 0x39b: 0x812d, 0x39c: 0x8132, 0x39d: 0x8132, + 0x39e: 0x8132, 0x39f: 0x8132, 0x3a0: 0x8132, 0x3a1: 0x8132, 0x3a2: 0x812d, 0x3a3: 0x812d, + 0x3a4: 0x812d, 0x3a5: 0x812d, 0x3a6: 0x812d, 0x3a7: 0x812d, 0x3a8: 0x8132, 0x3a9: 0x8132, + 0x3aa: 0x812d, 0x3ab: 0x8132, 0x3ac: 0x8132, 0x3ad: 0x812e, 0x3ae: 0x8131, 0x3af: 0x8132, + 0x3b0: 0x8105, 0x3b1: 0x8106, 0x3b2: 0x8107, 0x3b3: 0x8108, 0x3b4: 0x8109, 0x3b5: 0x810a, + 0x3b6: 0x810b, 0x3b7: 0x810c, 0x3b8: 0x810d, 0x3b9: 0x810e, 0x3ba: 0x810e, 0x3bb: 0x810f, + 0x3bc: 0x8110, 0x3bd: 0x8111, 0x3bf: 0x8112, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8116, + 0x3cc: 0x8117, 0x3cd: 0x8118, 0x3ce: 0x8119, 0x3cf: 0x811a, 0x3d0: 0x811b, 0x3d1: 0x811c, + 0x3d2: 0x811d, 0x3d3: 0x9932, 0x3d4: 0x9932, 0x3d5: 0x992d, 0x3d6: 0x812d, 0x3d7: 0x8132, + 0x3d8: 0x8132, 0x3d9: 0x8132, 0x3da: 0x8132, 0x3db: 0x8132, 0x3dc: 0x812d, 0x3dd: 0x8132, + 0x3de: 0x8132, 0x3df: 0x812d, + 0x3f0: 0x811e, 0x3f5: 0x1d84, + 0x3f6: 0x2013, 0x3f7: 0x204f, 0x3f8: 0x204a, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2d26, 0x407: 0xa000, 0x408: 0x2d2e, 0x409: 0xa000, 0x40a: 0x2d36, 0x40b: 0xa000, + 0x40c: 0x2d3e, 0x40d: 0xa000, 0x40e: 0x2d46, 0x411: 0xa000, + 0x412: 0x2d4e, + 0x434: 0x8102, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2d56, + 0x43c: 0xa000, 0x43d: 0x2d5e, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x0069, 0x441: 0x006b, 0x442: 0x006f, 0x443: 0x0083, 0x444: 0x00f5, 0x445: 0x00f8, + 0x446: 0x0413, 0x447: 0x0085, 0x448: 0x0089, 0x449: 0x008b, 0x44a: 0x0104, 0x44b: 0x0107, + 0x44c: 0x010a, 0x44d: 0x008f, 0x44f: 0x0097, 0x450: 0x009b, 0x451: 0x00e0, + 0x452: 0x009f, 0x453: 0x00fe, 0x454: 0x0417, 0x455: 0x041b, 0x456: 0x00a1, 0x457: 0x00a9, + 0x458: 0x00ab, 0x459: 0x0423, 0x45a: 0x012b, 0x45b: 0x00ad, 0x45c: 0x0427, 0x45d: 0x01be, + 0x45e: 0x01c1, 0x45f: 0x01c4, 0x460: 0x01fa, 0x461: 0x01fd, 0x462: 0x0093, 0x463: 0x00a5, + 0x464: 0x00ab, 0x465: 0x00ad, 0x466: 0x01be, 0x467: 0x01c1, 0x468: 0x01eb, 0x469: 0x01fa, + 0x46a: 0x01fd, + 0x478: 0x020c, + // Block 0x12, offset 0x480 + 0x49b: 0x00fb, 0x49c: 0x0087, 0x49d: 0x0101, + 0x49e: 0x00d4, 0x49f: 0x010a, 0x4a0: 0x008d, 0x4a1: 0x010d, 0x4a2: 0x0110, 0x4a3: 0x0116, + 0x4a4: 0x011c, 0x4a5: 0x011f, 0x4a6: 0x0122, 0x4a7: 0x042b, 0x4a8: 0x016a, 0x4a9: 0x0128, + 0x4aa: 0x042f, 0x4ab: 0x016d, 0x4ac: 0x0131, 0x4ad: 0x012e, 0x4ae: 0x0134, 0x4af: 0x0137, + 0x4b0: 0x013a, 0x4b1: 0x013d, 0x4b2: 0x0140, 0x4b3: 0x014c, 0x4b4: 0x014f, 0x4b5: 0x00ec, + 0x4b6: 0x0152, 0x4b7: 0x0155, 0x4b8: 0x041f, 0x4b9: 0x0158, 0x4ba: 0x015b, 0x4bb: 0x00b5, + 0x4bc: 0x015e, 0x4bd: 0x0161, 0x4be: 0x0164, 0x4bf: 0x01d0, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x8132, 0x4c1: 0x8132, 0x4c2: 0x812d, 0x4c3: 0x8132, 0x4c4: 0x8132, 0x4c5: 0x8132, + 0x4c6: 0x8132, 0x4c7: 0x8132, 0x4c8: 0x8132, 0x4c9: 0x8132, 0x4ca: 0x812d, 0x4cb: 0x8132, + 0x4cc: 0x8132, 0x4cd: 0x8135, 0x4ce: 0x812a, 0x4cf: 0x812d, 0x4d0: 0x8129, 0x4d1: 0x8132, + 0x4d2: 0x8132, 0x4d3: 0x8132, 0x4d4: 0x8132, 0x4d5: 0x8132, 0x4d6: 0x8132, 0x4d7: 0x8132, + 0x4d8: 0x8132, 0x4d9: 0x8132, 0x4da: 0x8132, 0x4db: 0x8132, 0x4dc: 0x8132, 0x4dd: 0x8132, + 0x4de: 0x8132, 0x4df: 0x8132, 0x4e0: 0x8132, 0x4e1: 0x8132, 0x4e2: 0x8132, 0x4e3: 0x8132, + 0x4e4: 0x8132, 0x4e5: 0x8132, 0x4e6: 0x8132, 0x4e7: 0x8132, 0x4e8: 0x8132, 0x4e9: 0x8132, + 0x4ea: 0x8132, 0x4eb: 0x8132, 0x4ec: 0x8132, 0x4ed: 0x8132, 0x4ee: 0x8132, 0x4ef: 0x8132, + 0x4f0: 0x8132, 0x4f1: 0x8132, 0x4f2: 0x8132, 0x4f3: 0x8132, 0x4f4: 0x8132, 0x4f5: 0x8132, + 0x4f6: 0x8133, 0x4f7: 0x8131, 0x4f8: 0x8131, 0x4f9: 0x812d, 0x4fb: 0x8132, + 0x4fc: 0x8134, 0x4fd: 0x812d, 0x4fe: 0x8132, 0x4ff: 0x812d, + // Block 0x14, offset 0x500 + 0x500: 0x2f97, 0x501: 0x32a3, 0x502: 0x2fa1, 0x503: 0x32ad, 0x504: 0x2fa6, 0x505: 0x32b2, + 0x506: 0x2fab, 0x507: 0x32b7, 0x508: 0x38cc, 0x509: 0x3a5b, 0x50a: 0x2fc4, 0x50b: 0x32d0, + 0x50c: 0x2fce, 0x50d: 0x32da, 0x50e: 0x2fdd, 0x50f: 0x32e9, 0x510: 0x2fd3, 0x511: 0x32df, + 0x512: 0x2fd8, 0x513: 0x32e4, 0x514: 0x38ef, 0x515: 0x3a7e, 0x516: 0x38f6, 0x517: 0x3a85, + 0x518: 0x3019, 0x519: 0x3325, 0x51a: 0x301e, 0x51b: 0x332a, 0x51c: 0x3904, 0x51d: 0x3a93, + 0x51e: 0x3023, 0x51f: 0x332f, 0x520: 0x3032, 0x521: 0x333e, 0x522: 0x3050, 0x523: 0x335c, + 0x524: 0x305f, 0x525: 0x336b, 0x526: 0x3055, 0x527: 0x3361, 0x528: 0x3064, 0x529: 0x3370, + 0x52a: 0x3069, 0x52b: 0x3375, 0x52c: 0x30af, 0x52d: 0x33bb, 0x52e: 0x390b, 0x52f: 0x3a9a, + 0x530: 0x30b9, 0x531: 0x33ca, 0x532: 0x30c3, 0x533: 0x33d4, 0x534: 0x30cd, 0x535: 0x33de, + 0x536: 0x46c4, 0x537: 0x4755, 0x538: 0x3912, 0x539: 0x3aa1, 0x53a: 0x30e6, 0x53b: 0x33f7, + 0x53c: 0x30e1, 0x53d: 0x33f2, 0x53e: 0x30eb, 0x53f: 0x33fc, + // Block 0x15, offset 0x540 + 0x540: 0x30f0, 0x541: 0x3401, 0x542: 0x30f5, 0x543: 0x3406, 0x544: 0x3109, 0x545: 0x341a, + 0x546: 0x3113, 0x547: 0x3424, 0x548: 0x3122, 0x549: 0x3433, 0x54a: 0x311d, 0x54b: 0x342e, + 0x54c: 0x3935, 0x54d: 0x3ac4, 0x54e: 0x3943, 0x54f: 0x3ad2, 0x550: 0x394a, 0x551: 0x3ad9, + 0x552: 0x3951, 0x553: 0x3ae0, 0x554: 0x314f, 0x555: 0x3460, 0x556: 0x3154, 0x557: 0x3465, + 0x558: 0x315e, 0x559: 0x346f, 0x55a: 0x46f1, 0x55b: 0x4782, 0x55c: 0x3997, 0x55d: 0x3b26, + 0x55e: 0x3177, 0x55f: 0x3488, 0x560: 0x3181, 0x561: 0x3492, 0x562: 0x4700, 0x563: 0x4791, + 0x564: 0x399e, 0x565: 0x3b2d, 0x566: 0x39a5, 0x567: 0x3b34, 0x568: 0x39ac, 0x569: 0x3b3b, + 0x56a: 0x3190, 0x56b: 0x34a1, 0x56c: 0x319a, 0x56d: 0x34b0, 0x56e: 0x31ae, 0x56f: 0x34c4, + 0x570: 0x31a9, 0x571: 0x34bf, 0x572: 0x31ea, 0x573: 0x3500, 0x574: 0x31f9, 0x575: 0x350f, + 0x576: 0x31f4, 0x577: 0x350a, 0x578: 0x39b3, 0x579: 0x3b42, 0x57a: 0x39ba, 0x57b: 0x3b49, + 0x57c: 0x31fe, 0x57d: 0x3514, 0x57e: 0x3203, 0x57f: 0x3519, + // Block 0x16, offset 0x580 + 0x580: 0x3208, 0x581: 0x351e, 0x582: 0x320d, 0x583: 0x3523, 0x584: 0x321c, 0x585: 0x3532, + 0x586: 0x3217, 0x587: 0x352d, 0x588: 0x3221, 0x589: 0x353c, 0x58a: 0x3226, 0x58b: 0x3541, + 0x58c: 0x322b, 0x58d: 0x3546, 0x58e: 0x3249, 0x58f: 0x3564, 0x590: 0x3262, 0x591: 0x3582, + 0x592: 0x3271, 0x593: 0x3591, 0x594: 0x3276, 0x595: 0x3596, 0x596: 0x337a, 0x597: 0x34a6, + 0x598: 0x3537, 0x599: 0x3573, 0x59a: 0x1be0, 0x59b: 0x42d7, + 0x5a0: 0x46a1, 0x5a1: 0x4732, 0x5a2: 0x2f83, 0x5a3: 0x328f, + 0x5a4: 0x3878, 0x5a5: 0x3a07, 0x5a6: 0x3871, 0x5a7: 0x3a00, 0x5a8: 0x3886, 0x5a9: 0x3a15, + 0x5aa: 0x387f, 0x5ab: 0x3a0e, 0x5ac: 0x38be, 0x5ad: 0x3a4d, 0x5ae: 0x3894, 0x5af: 0x3a23, + 0x5b0: 0x388d, 0x5b1: 0x3a1c, 0x5b2: 0x38a2, 0x5b3: 0x3a31, 0x5b4: 0x389b, 0x5b5: 0x3a2a, + 0x5b6: 0x38c5, 0x5b7: 0x3a54, 0x5b8: 0x46b5, 0x5b9: 0x4746, 0x5ba: 0x3000, 0x5bb: 0x330c, + 0x5bc: 0x2fec, 0x5bd: 0x32f8, 0x5be: 0x38da, 0x5bf: 0x3a69, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x38d3, 0x5c1: 0x3a62, 0x5c2: 0x38e8, 0x5c3: 0x3a77, 0x5c4: 0x38e1, 0x5c5: 0x3a70, + 0x5c6: 0x38fd, 0x5c7: 0x3a8c, 0x5c8: 0x3091, 0x5c9: 0x339d, 0x5ca: 0x30a5, 0x5cb: 0x33b1, + 0x5cc: 0x46e7, 0x5cd: 0x4778, 0x5ce: 0x3136, 0x5cf: 0x3447, 0x5d0: 0x3920, 0x5d1: 0x3aaf, + 0x5d2: 0x3919, 0x5d3: 0x3aa8, 0x5d4: 0x392e, 0x5d5: 0x3abd, 0x5d6: 0x3927, 0x5d7: 0x3ab6, + 0x5d8: 0x3989, 0x5d9: 0x3b18, 0x5da: 0x396d, 0x5db: 0x3afc, 0x5dc: 0x3966, 0x5dd: 0x3af5, + 0x5de: 0x397b, 0x5df: 0x3b0a, 0x5e0: 0x3974, 0x5e1: 0x3b03, 0x5e2: 0x3982, 0x5e3: 0x3b11, + 0x5e4: 0x31e5, 0x5e5: 0x34fb, 0x5e6: 0x31c7, 0x5e7: 0x34dd, 0x5e8: 0x39e4, 0x5e9: 0x3b73, + 0x5ea: 0x39dd, 0x5eb: 0x3b6c, 0x5ec: 0x39f2, 0x5ed: 0x3b81, 0x5ee: 0x39eb, 0x5ef: 0x3b7a, + 0x5f0: 0x39f9, 0x5f1: 0x3b88, 0x5f2: 0x3230, 0x5f3: 0x354b, 0x5f4: 0x3258, 0x5f5: 0x3578, + 0x5f6: 0x3253, 0x5f7: 0x356e, 0x5f8: 0x323f, 0x5f9: 0x355a, + // Block 0x18, offset 0x600 + 0x600: 0x4804, 0x601: 0x480a, 0x602: 0x491e, 0x603: 0x4936, 0x604: 0x4926, 0x605: 0x493e, + 0x606: 0x492e, 0x607: 0x4946, 0x608: 0x47aa, 0x609: 0x47b0, 0x60a: 0x488e, 0x60b: 0x48a6, + 0x60c: 0x4896, 0x60d: 0x48ae, 0x60e: 0x489e, 0x60f: 0x48b6, 0x610: 0x4816, 0x611: 0x481c, + 0x612: 0x3db8, 0x613: 0x3dc8, 0x614: 0x3dc0, 0x615: 0x3dd0, + 0x618: 0x47b6, 0x619: 0x47bc, 0x61a: 0x3ce8, 0x61b: 0x3cf8, 0x61c: 0x3cf0, 0x61d: 0x3d00, + 0x620: 0x482e, 0x621: 0x4834, 0x622: 0x494e, 0x623: 0x4966, + 0x624: 0x4956, 0x625: 0x496e, 0x626: 0x495e, 0x627: 0x4976, 0x628: 0x47c2, 0x629: 0x47c8, + 0x62a: 0x48be, 0x62b: 0x48d6, 0x62c: 0x48c6, 0x62d: 0x48de, 0x62e: 0x48ce, 0x62f: 0x48e6, + 0x630: 0x4846, 0x631: 0x484c, 0x632: 0x3e18, 0x633: 0x3e30, 0x634: 0x3e20, 0x635: 0x3e38, + 0x636: 0x3e28, 0x637: 0x3e40, 0x638: 0x47ce, 0x639: 0x47d4, 0x63a: 0x3d18, 0x63b: 0x3d30, + 0x63c: 0x3d20, 0x63d: 0x3d38, 0x63e: 0x3d28, 0x63f: 0x3d40, + // Block 0x19, offset 0x640 + 0x640: 0x4852, 0x641: 0x4858, 0x642: 0x3e48, 0x643: 0x3e58, 0x644: 0x3e50, 0x645: 0x3e60, + 0x648: 0x47da, 0x649: 0x47e0, 0x64a: 0x3d48, 0x64b: 0x3d58, + 0x64c: 0x3d50, 0x64d: 0x3d60, 0x650: 0x4864, 0x651: 0x486a, + 0x652: 0x3e80, 0x653: 0x3e98, 0x654: 0x3e88, 0x655: 0x3ea0, 0x656: 0x3e90, 0x657: 0x3ea8, + 0x659: 0x47e6, 0x65b: 0x3d68, 0x65d: 0x3d70, + 0x65f: 0x3d78, 0x660: 0x487c, 0x661: 0x4882, 0x662: 0x497e, 0x663: 0x4996, + 0x664: 0x4986, 0x665: 0x499e, 0x666: 0x498e, 0x667: 0x49a6, 0x668: 0x47ec, 0x669: 0x47f2, + 0x66a: 0x48ee, 0x66b: 0x4906, 0x66c: 0x48f6, 0x66d: 0x490e, 0x66e: 0x48fe, 0x66f: 0x4916, + 0x670: 0x47f8, 0x671: 0x431e, 0x672: 0x3691, 0x673: 0x4324, 0x674: 0x4822, 0x675: 0x432a, + 0x676: 0x36a3, 0x677: 0x4330, 0x678: 0x36c1, 0x679: 0x4336, 0x67a: 0x36d9, 0x67b: 0x433c, + 0x67c: 0x4870, 0x67d: 0x4342, + // Block 0x1a, offset 0x680 + 0x680: 0x3da0, 0x681: 0x3da8, 0x682: 0x4184, 0x683: 0x41a2, 0x684: 0x418e, 0x685: 0x41ac, + 0x686: 0x4198, 0x687: 0x41b6, 0x688: 0x3cd8, 0x689: 0x3ce0, 0x68a: 0x40d0, 0x68b: 0x40ee, + 0x68c: 0x40da, 0x68d: 0x40f8, 0x68e: 0x40e4, 0x68f: 0x4102, 0x690: 0x3de8, 0x691: 0x3df0, + 0x692: 0x41c0, 0x693: 0x41de, 0x694: 0x41ca, 0x695: 0x41e8, 0x696: 0x41d4, 0x697: 0x41f2, + 0x698: 0x3d08, 0x699: 0x3d10, 0x69a: 0x410c, 0x69b: 0x412a, 0x69c: 0x4116, 0x69d: 0x4134, + 0x69e: 0x4120, 0x69f: 0x413e, 0x6a0: 0x3ec0, 0x6a1: 0x3ec8, 0x6a2: 0x41fc, 0x6a3: 0x421a, + 0x6a4: 0x4206, 0x6a5: 0x4224, 0x6a6: 0x4210, 0x6a7: 0x422e, 0x6a8: 0x3d80, 0x6a9: 0x3d88, + 0x6aa: 0x4148, 0x6ab: 0x4166, 0x6ac: 0x4152, 0x6ad: 0x4170, 0x6ae: 0x415c, 0x6af: 0x417a, + 0x6b0: 0x3685, 0x6b1: 0x367f, 0x6b2: 0x3d90, 0x6b3: 0x368b, 0x6b4: 0x3d98, + 0x6b6: 0x4810, 0x6b7: 0x3db0, 0x6b8: 0x35f5, 0x6b9: 0x35ef, 0x6ba: 0x35e3, 0x6bb: 0x42ee, + 0x6bc: 0x35fb, 0x6bd: 0x4287, 0x6be: 0x01d3, 0x6bf: 0x4287, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x42a0, 0x6c1: 0x4482, 0x6c2: 0x3dd8, 0x6c3: 0x369d, 0x6c4: 0x3de0, + 0x6c6: 0x483a, 0x6c7: 0x3df8, 0x6c8: 0x3601, 0x6c9: 0x42f4, 0x6ca: 0x360d, 0x6cb: 0x42fa, + 0x6cc: 0x3619, 0x6cd: 0x4489, 0x6ce: 0x4490, 0x6cf: 0x4497, 0x6d0: 0x36b5, 0x6d1: 0x36af, + 0x6d2: 0x3e00, 0x6d3: 0x44e4, 0x6d6: 0x36bb, 0x6d7: 0x3e10, + 0x6d8: 0x3631, 0x6d9: 0x362b, 0x6da: 0x361f, 0x6db: 0x4300, 0x6dd: 0x449e, + 0x6de: 0x44a5, 0x6df: 0x44ac, 0x6e0: 0x36eb, 0x6e1: 0x36e5, 0x6e2: 0x3e68, 0x6e3: 0x44ec, + 0x6e4: 0x36cd, 0x6e5: 0x36d3, 0x6e6: 0x36f1, 0x6e7: 0x3e78, 0x6e8: 0x3661, 0x6e9: 0x365b, + 0x6ea: 0x364f, 0x6eb: 0x430c, 0x6ec: 0x3649, 0x6ed: 0x4474, 0x6ee: 0x447b, 0x6ef: 0x0081, + 0x6f2: 0x3eb0, 0x6f3: 0x36f7, 0x6f4: 0x3eb8, + 0x6f6: 0x4888, 0x6f7: 0x3ed0, 0x6f8: 0x363d, 0x6f9: 0x4306, 0x6fa: 0x366d, 0x6fb: 0x4318, + 0x6fc: 0x3679, 0x6fd: 0x425a, 0x6fe: 0x428c, + // Block 0x1c, offset 0x700 + 0x700: 0x1bd8, 0x701: 0x1bdc, 0x702: 0x0047, 0x703: 0x1c54, 0x705: 0x1be8, + 0x706: 0x1bec, 0x707: 0x00e9, 0x709: 0x1c58, 0x70a: 0x008f, 0x70b: 0x0051, + 0x70c: 0x0051, 0x70d: 0x0051, 0x70e: 0x0091, 0x70f: 0x00da, 0x710: 0x0053, 0x711: 0x0053, + 0x712: 0x0059, 0x713: 0x0099, 0x715: 0x005d, 0x716: 0x198d, + 0x719: 0x0061, 0x71a: 0x0063, 0x71b: 0x0065, 0x71c: 0x0065, 0x71d: 0x0065, + 0x720: 0x199f, 0x721: 0x1bc8, 0x722: 0x19a8, + 0x724: 0x0075, 0x726: 0x01b8, 0x728: 0x0075, + 0x72a: 0x0057, 0x72b: 0x42d2, 0x72c: 0x0045, 0x72d: 0x0047, 0x72f: 0x008b, + 0x730: 0x004b, 0x731: 0x004d, 0x733: 0x005b, 0x734: 0x009f, 0x735: 0x0215, + 0x736: 0x0218, 0x737: 0x021b, 0x738: 0x021e, 0x739: 0x0093, 0x73b: 0x1b98, + 0x73c: 0x01e8, 0x73d: 0x01c1, 0x73e: 0x0179, 0x73f: 0x01a0, + // Block 0x1d, offset 0x740 + 0x740: 0x0463, 0x745: 0x0049, + 0x746: 0x0089, 0x747: 0x008b, 0x748: 0x0093, 0x749: 0x0095, + 0x750: 0x222e, 0x751: 0x223a, + 0x752: 0x22ee, 0x753: 0x2216, 0x754: 0x229a, 0x755: 0x2222, 0x756: 0x22a0, 0x757: 0x22b8, + 0x758: 0x22c4, 0x759: 0x2228, 0x75a: 0x22ca, 0x75b: 0x2234, 0x75c: 0x22be, 0x75d: 0x22d0, + 0x75e: 0x22d6, 0x75f: 0x1cbc, 0x760: 0x0053, 0x761: 0x195a, 0x762: 0x1ba4, 0x763: 0x1963, + 0x764: 0x006d, 0x765: 0x19ab, 0x766: 0x1bd0, 0x767: 0x1d48, 0x768: 0x1966, 0x769: 0x0071, + 0x76a: 0x19b7, 0x76b: 0x1bd4, 0x76c: 0x0059, 0x76d: 0x0047, 0x76e: 0x0049, 0x76f: 0x005b, + 0x770: 0x0093, 0x771: 0x19e4, 0x772: 0x1c18, 0x773: 0x19ed, 0x774: 0x00ad, 0x775: 0x1a62, + 0x776: 0x1c4c, 0x777: 0x1d5c, 0x778: 0x19f0, 0x779: 0x00b1, 0x77a: 0x1a65, 0x77b: 0x1c50, + 0x77c: 0x0099, 0x77d: 0x0087, 0x77e: 0x0089, 0x77f: 0x009b, + // Block 0x1e, offset 0x780 + 0x781: 0x3c06, 0x783: 0xa000, 0x784: 0x3c0d, 0x785: 0xa000, + 0x787: 0x3c14, 0x788: 0xa000, 0x789: 0x3c1b, + 0x78d: 0xa000, + 0x7a0: 0x2f65, 0x7a1: 0xa000, 0x7a2: 0x3c29, + 0x7a4: 0xa000, 0x7a5: 0xa000, + 0x7ad: 0x3c22, 0x7ae: 0x2f60, 0x7af: 0x2f6a, + 0x7b0: 0x3c30, 0x7b1: 0x3c37, 0x7b2: 0xa000, 0x7b3: 0xa000, 0x7b4: 0x3c3e, 0x7b5: 0x3c45, + 0x7b6: 0xa000, 0x7b7: 0xa000, 0x7b8: 0x3c4c, 0x7b9: 0x3c53, 0x7ba: 0xa000, 0x7bb: 0xa000, + 0x7bc: 0xa000, 0x7bd: 0xa000, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x3c5a, 0x7c1: 0x3c61, 0x7c2: 0xa000, 0x7c3: 0xa000, 0x7c4: 0x3c76, 0x7c5: 0x3c7d, + 0x7c6: 0xa000, 0x7c7: 0xa000, 0x7c8: 0x3c84, 0x7c9: 0x3c8b, + 0x7d1: 0xa000, + 0x7d2: 0xa000, + 0x7e2: 0xa000, + 0x7e8: 0xa000, 0x7e9: 0xa000, + 0x7eb: 0xa000, 0x7ec: 0x3ca0, 0x7ed: 0x3ca7, 0x7ee: 0x3cae, 0x7ef: 0x3cb5, + 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0xa000, 0x7f5: 0xa000, + // Block 0x20, offset 0x800 + 0x820: 0x0023, 0x821: 0x0025, 0x822: 0x0027, 0x823: 0x0029, + 0x824: 0x002b, 0x825: 0x002d, 0x826: 0x002f, 0x827: 0x0031, 0x828: 0x0033, 0x829: 0x1882, + 0x82a: 0x1885, 0x82b: 0x1888, 0x82c: 0x188b, 0x82d: 0x188e, 0x82e: 0x1891, 0x82f: 0x1894, + 0x830: 0x1897, 0x831: 0x189a, 0x832: 0x189d, 0x833: 0x18a6, 0x834: 0x1a68, 0x835: 0x1a6c, + 0x836: 0x1a70, 0x837: 0x1a74, 0x838: 0x1a78, 0x839: 0x1a7c, 0x83a: 0x1a80, 0x83b: 0x1a84, + 0x83c: 0x1a88, 0x83d: 0x1c80, 0x83e: 0x1c85, 0x83f: 0x1c8a, + // Block 0x21, offset 0x840 + 0x840: 0x1c8f, 0x841: 0x1c94, 0x842: 0x1c99, 0x843: 0x1c9e, 0x844: 0x1ca3, 0x845: 0x1ca8, + 0x846: 0x1cad, 0x847: 0x1cb2, 0x848: 0x187f, 0x849: 0x18a3, 0x84a: 0x18c7, 0x84b: 0x18eb, + 0x84c: 0x190f, 0x84d: 0x1918, 0x84e: 0x191e, 0x84f: 0x1924, 0x850: 0x192a, 0x851: 0x1b60, + 0x852: 0x1b64, 0x853: 0x1b68, 0x854: 0x1b6c, 0x855: 0x1b70, 0x856: 0x1b74, 0x857: 0x1b78, + 0x858: 0x1b7c, 0x859: 0x1b80, 0x85a: 0x1b84, 0x85b: 0x1b88, 0x85c: 0x1af4, 0x85d: 0x1af8, + 0x85e: 0x1afc, 0x85f: 0x1b00, 0x860: 0x1b04, 0x861: 0x1b08, 0x862: 0x1b0c, 0x863: 0x1b10, + 0x864: 0x1b14, 0x865: 0x1b18, 0x866: 0x1b1c, 0x867: 0x1b20, 0x868: 0x1b24, 0x869: 0x1b28, + 0x86a: 0x1b2c, 0x86b: 0x1b30, 0x86c: 0x1b34, 0x86d: 0x1b38, 0x86e: 0x1b3c, 0x86f: 0x1b40, + 0x870: 0x1b44, 0x871: 0x1b48, 0x872: 0x1b4c, 0x873: 0x1b50, 0x874: 0x1b54, 0x875: 0x1b58, + 0x876: 0x0043, 0x877: 0x0045, 0x878: 0x0047, 0x879: 0x0049, 0x87a: 0x004b, 0x87b: 0x004d, + 0x87c: 0x004f, 0x87d: 0x0051, 0x87e: 0x0053, 0x87f: 0x0055, + // Block 0x22, offset 0x880 + 0x880: 0x06bf, 0x881: 0x06e3, 0x882: 0x06ef, 0x883: 0x06ff, 0x884: 0x0707, 0x885: 0x0713, + 0x886: 0x071b, 0x887: 0x0723, 0x888: 0x072f, 0x889: 0x0783, 0x88a: 0x079b, 0x88b: 0x07ab, + 0x88c: 0x07bb, 0x88d: 0x07cb, 0x88e: 0x07db, 0x88f: 0x07fb, 0x890: 0x07ff, 0x891: 0x0803, + 0x892: 0x0837, 0x893: 0x085f, 0x894: 0x086f, 0x895: 0x0877, 0x896: 0x087b, 0x897: 0x0887, + 0x898: 0x08a3, 0x899: 0x08a7, 0x89a: 0x08bf, 0x89b: 0x08c3, 0x89c: 0x08cb, 0x89d: 0x08db, + 0x89e: 0x0977, 0x89f: 0x098b, 0x8a0: 0x09cb, 0x8a1: 0x09df, 0x8a2: 0x09e7, 0x8a3: 0x09eb, + 0x8a4: 0x09fb, 0x8a5: 0x0a17, 0x8a6: 0x0a43, 0x8a7: 0x0a4f, 0x8a8: 0x0a6f, 0x8a9: 0x0a7b, + 0x8aa: 0x0a7f, 0x8ab: 0x0a83, 0x8ac: 0x0a9b, 0x8ad: 0x0a9f, 0x8ae: 0x0acb, 0x8af: 0x0ad7, + 0x8b0: 0x0adf, 0x8b1: 0x0ae7, 0x8b2: 0x0af7, 0x8b3: 0x0aff, 0x8b4: 0x0b07, 0x8b5: 0x0b33, + 0x8b6: 0x0b37, 0x8b7: 0x0b3f, 0x8b8: 0x0b43, 0x8b9: 0x0b4b, 0x8ba: 0x0b53, 0x8bb: 0x0b63, + 0x8bc: 0x0b7f, 0x8bd: 0x0bf7, 0x8be: 0x0c0b, 0x8bf: 0x0c0f, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0c8f, 0x8c1: 0x0c93, 0x8c2: 0x0ca7, 0x8c3: 0x0cab, 0x8c4: 0x0cb3, 0x8c5: 0x0cbb, + 0x8c6: 0x0cc3, 0x8c7: 0x0ccf, 0x8c8: 0x0cf7, 0x8c9: 0x0d07, 0x8ca: 0x0d1b, 0x8cb: 0x0d8b, + 0x8cc: 0x0d97, 0x8cd: 0x0da7, 0x8ce: 0x0db3, 0x8cf: 0x0dbf, 0x8d0: 0x0dc7, 0x8d1: 0x0dcb, + 0x8d2: 0x0dcf, 0x8d3: 0x0dd3, 0x8d4: 0x0dd7, 0x8d5: 0x0e8f, 0x8d6: 0x0ed7, 0x8d7: 0x0ee3, + 0x8d8: 0x0ee7, 0x8d9: 0x0eeb, 0x8da: 0x0eef, 0x8db: 0x0ef7, 0x8dc: 0x0efb, 0x8dd: 0x0f0f, + 0x8de: 0x0f2b, 0x8df: 0x0f33, 0x8e0: 0x0f73, 0x8e1: 0x0f77, 0x8e2: 0x0f7f, 0x8e3: 0x0f83, + 0x8e4: 0x0f8b, 0x8e5: 0x0f8f, 0x8e6: 0x0fb3, 0x8e7: 0x0fb7, 0x8e8: 0x0fd3, 0x8e9: 0x0fd7, + 0x8ea: 0x0fdb, 0x8eb: 0x0fdf, 0x8ec: 0x0ff3, 0x8ed: 0x1017, 0x8ee: 0x101b, 0x8ef: 0x101f, + 0x8f0: 0x1043, 0x8f1: 0x1083, 0x8f2: 0x1087, 0x8f3: 0x10a7, 0x8f4: 0x10b7, 0x8f5: 0x10bf, + 0x8f6: 0x10df, 0x8f7: 0x1103, 0x8f8: 0x1147, 0x8f9: 0x114f, 0x8fa: 0x1163, 0x8fb: 0x116f, + 0x8fc: 0x1177, 0x8fd: 0x117f, 0x8fe: 0x1183, 0x8ff: 0x1187, + // Block 0x24, offset 0x900 + 0x900: 0x119f, 0x901: 0x11a3, 0x902: 0x11bf, 0x903: 0x11c7, 0x904: 0x11cf, 0x905: 0x11d3, + 0x906: 0x11df, 0x907: 0x11e7, 0x908: 0x11eb, 0x909: 0x11ef, 0x90a: 0x11f7, 0x90b: 0x11fb, + 0x90c: 0x129b, 0x90d: 0x12af, 0x90e: 0x12e3, 0x90f: 0x12e7, 0x910: 0x12ef, 0x911: 0x131b, + 0x912: 0x1323, 0x913: 0x132b, 0x914: 0x1333, 0x915: 0x136f, 0x916: 0x1373, 0x917: 0x137b, + 0x918: 0x137f, 0x919: 0x1383, 0x91a: 0x13af, 0x91b: 0x13b3, 0x91c: 0x13bb, 0x91d: 0x13cf, + 0x91e: 0x13d3, 0x91f: 0x13ef, 0x920: 0x13f7, 0x921: 0x13fb, 0x922: 0x141f, 0x923: 0x143f, + 0x924: 0x1453, 0x925: 0x1457, 0x926: 0x145f, 0x927: 0x148b, 0x928: 0x148f, 0x929: 0x149f, + 0x92a: 0x14c3, 0x92b: 0x14cf, 0x92c: 0x14df, 0x92d: 0x14f7, 0x92e: 0x14ff, 0x92f: 0x1503, + 0x930: 0x1507, 0x931: 0x150b, 0x932: 0x1517, 0x933: 0x151b, 0x934: 0x1523, 0x935: 0x153f, + 0x936: 0x1543, 0x937: 0x1547, 0x938: 0x155f, 0x939: 0x1563, 0x93a: 0x156b, 0x93b: 0x157f, + 0x93c: 0x1583, 0x93d: 0x1587, 0x93e: 0x158f, 0x93f: 0x1593, + // Block 0x25, offset 0x940 + 0x946: 0xa000, 0x94b: 0xa000, + 0x94c: 0x3f08, 0x94d: 0xa000, 0x94e: 0x3f10, 0x94f: 0xa000, 0x950: 0x3f18, 0x951: 0xa000, + 0x952: 0x3f20, 0x953: 0xa000, 0x954: 0x3f28, 0x955: 0xa000, 0x956: 0x3f30, 0x957: 0xa000, + 0x958: 0x3f38, 0x959: 0xa000, 0x95a: 0x3f40, 0x95b: 0xa000, 0x95c: 0x3f48, 0x95d: 0xa000, + 0x95e: 0x3f50, 0x95f: 0xa000, 0x960: 0x3f58, 0x961: 0xa000, 0x962: 0x3f60, + 0x964: 0xa000, 0x965: 0x3f68, 0x966: 0xa000, 0x967: 0x3f70, 0x968: 0xa000, 0x969: 0x3f78, + 0x96f: 0xa000, + 0x970: 0x3f80, 0x971: 0x3f88, 0x972: 0xa000, 0x973: 0x3f90, 0x974: 0x3f98, 0x975: 0xa000, + 0x976: 0x3fa0, 0x977: 0x3fa8, 0x978: 0xa000, 0x979: 0x3fb0, 0x97a: 0x3fb8, 0x97b: 0xa000, + 0x97c: 0x3fc0, 0x97d: 0x3fc8, + // Block 0x26, offset 0x980 + 0x994: 0x3f00, + 0x999: 0x9903, 0x99a: 0x9903, 0x99b: 0x42dc, 0x99c: 0x42e2, 0x99d: 0xa000, + 0x99e: 0x3fd0, 0x99f: 0x26b4, + 0x9a6: 0xa000, + 0x9ab: 0xa000, 0x9ac: 0x3fe0, 0x9ad: 0xa000, 0x9ae: 0x3fe8, 0x9af: 0xa000, + 0x9b0: 0x3ff0, 0x9b1: 0xa000, 0x9b2: 0x3ff8, 0x9b3: 0xa000, 0x9b4: 0x4000, 0x9b5: 0xa000, + 0x9b6: 0x4008, 0x9b7: 0xa000, 0x9b8: 0x4010, 0x9b9: 0xa000, 0x9ba: 0x4018, 0x9bb: 0xa000, + 0x9bc: 0x4020, 0x9bd: 0xa000, 0x9be: 0x4028, 0x9bf: 0xa000, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x4030, 0x9c1: 0xa000, 0x9c2: 0x4038, 0x9c4: 0xa000, 0x9c5: 0x4040, + 0x9c6: 0xa000, 0x9c7: 0x4048, 0x9c8: 0xa000, 0x9c9: 0x4050, + 0x9cf: 0xa000, 0x9d0: 0x4058, 0x9d1: 0x4060, + 0x9d2: 0xa000, 0x9d3: 0x4068, 0x9d4: 0x4070, 0x9d5: 0xa000, 0x9d6: 0x4078, 0x9d7: 0x4080, + 0x9d8: 0xa000, 0x9d9: 0x4088, 0x9da: 0x4090, 0x9db: 0xa000, 0x9dc: 0x4098, 0x9dd: 0x40a0, + 0x9ef: 0xa000, + 0x9f0: 0xa000, 0x9f1: 0xa000, 0x9f2: 0xa000, 0x9f4: 0x3fd8, + 0x9f7: 0x40a8, 0x9f8: 0x40b0, 0x9f9: 0x40b8, 0x9fa: 0x40c0, + 0x9fd: 0xa000, 0x9fe: 0x40c8, 0x9ff: 0x26c9, + // Block 0x28, offset 0xa00 + 0xa00: 0x0367, 0xa01: 0x032b, 0xa02: 0x032f, 0xa03: 0x0333, 0xa04: 0x037b, 0xa05: 0x0337, + 0xa06: 0x033b, 0xa07: 0x033f, 0xa08: 0x0343, 0xa09: 0x0347, 0xa0a: 0x034b, 0xa0b: 0x034f, + 0xa0c: 0x0353, 0xa0d: 0x0357, 0xa0e: 0x035b, 0xa0f: 0x49bd, 0xa10: 0x49c3, 0xa11: 0x49c9, + 0xa12: 0x49cf, 0xa13: 0x49d5, 0xa14: 0x49db, 0xa15: 0x49e1, 0xa16: 0x49e7, 0xa17: 0x49ed, + 0xa18: 0x49f3, 0xa19: 0x49f9, 0xa1a: 0x49ff, 0xa1b: 0x4a05, 0xa1c: 0x4a0b, 0xa1d: 0x4a11, + 0xa1e: 0x4a17, 0xa1f: 0x4a1d, 0xa20: 0x4a23, 0xa21: 0x4a29, 0xa22: 0x4a2f, 0xa23: 0x4a35, + 0xa24: 0x03c3, 0xa25: 0x035f, 0xa26: 0x0363, 0xa27: 0x03e7, 0xa28: 0x03eb, 0xa29: 0x03ef, + 0xa2a: 0x03f3, 0xa2b: 0x03f7, 0xa2c: 0x03fb, 0xa2d: 0x03ff, 0xa2e: 0x036b, 0xa2f: 0x0403, + 0xa30: 0x0407, 0xa31: 0x036f, 0xa32: 0x0373, 0xa33: 0x0377, 0xa34: 0x037f, 0xa35: 0x0383, + 0xa36: 0x0387, 0xa37: 0x038b, 0xa38: 0x038f, 0xa39: 0x0393, 0xa3a: 0x0397, 0xa3b: 0x039b, + 0xa3c: 0x039f, 0xa3d: 0x03a3, 0xa3e: 0x03a7, 0xa3f: 0x03ab, + // Block 0x29, offset 0xa40 + 0xa40: 0x03af, 0xa41: 0x03b3, 0xa42: 0x040b, 0xa43: 0x040f, 0xa44: 0x03b7, 0xa45: 0x03bb, + 0xa46: 0x03bf, 0xa47: 0x03c7, 0xa48: 0x03cb, 0xa49: 0x03cf, 0xa4a: 0x03d3, 0xa4b: 0x03d7, + 0xa4c: 0x03db, 0xa4d: 0x03df, 0xa4e: 0x03e3, + 0xa52: 0x06bf, 0xa53: 0x071b, 0xa54: 0x06cb, 0xa55: 0x097b, 0xa56: 0x06cf, 0xa57: 0x06e7, + 0xa58: 0x06d3, 0xa59: 0x0f93, 0xa5a: 0x0707, 0xa5b: 0x06db, 0xa5c: 0x06c3, 0xa5d: 0x09ff, + 0xa5e: 0x098f, 0xa5f: 0x072f, + // Block 0x2a, offset 0xa80 + 0xa80: 0x2054, 0xa81: 0x205a, 0xa82: 0x2060, 0xa83: 0x2066, 0xa84: 0x206c, 0xa85: 0x2072, + 0xa86: 0x2078, 0xa87: 0x207e, 0xa88: 0x2084, 0xa89: 0x208a, 0xa8a: 0x2090, 0xa8b: 0x2096, + 0xa8c: 0x209c, 0xa8d: 0x20a2, 0xa8e: 0x2726, 0xa8f: 0x272f, 0xa90: 0x2738, 0xa91: 0x2741, + 0xa92: 0x274a, 0xa93: 0x2753, 0xa94: 0x275c, 0xa95: 0x2765, 0xa96: 0x276e, 0xa97: 0x2780, + 0xa98: 0x2789, 0xa99: 0x2792, 0xa9a: 0x279b, 0xa9b: 0x27a4, 0xa9c: 0x2777, 0xa9d: 0x2bac, + 0xa9e: 0x2aed, 0xaa0: 0x20a8, 0xaa1: 0x20c0, 0xaa2: 0x20b4, 0xaa3: 0x2108, + 0xaa4: 0x20c6, 0xaa5: 0x20e4, 0xaa6: 0x20ae, 0xaa7: 0x20de, 0xaa8: 0x20ba, 0xaa9: 0x20f0, + 0xaaa: 0x2120, 0xaab: 0x213e, 0xaac: 0x2138, 0xaad: 0x212c, 0xaae: 0x217a, 0xaaf: 0x210e, + 0xab0: 0x211a, 0xab1: 0x2132, 0xab2: 0x2126, 0xab3: 0x2150, 0xab4: 0x20fc, 0xab5: 0x2144, + 0xab6: 0x216e, 0xab7: 0x2156, 0xab8: 0x20ea, 0xab9: 0x20cc, 0xaba: 0x2102, 0xabb: 0x2114, + 0xabc: 0x214a, 0xabd: 0x20d2, 0xabe: 0x2174, 0xabf: 0x20f6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x215c, 0xac1: 0x20d8, 0xac2: 0x2162, 0xac3: 0x2168, 0xac4: 0x092f, 0xac5: 0x0b03, + 0xac6: 0x0ca7, 0xac7: 0x10c7, + 0xad0: 0x1bc4, 0xad1: 0x18a9, + 0xad2: 0x18ac, 0xad3: 0x18af, 0xad4: 0x18b2, 0xad5: 0x18b5, 0xad6: 0x18b8, 0xad7: 0x18bb, + 0xad8: 0x18be, 0xad9: 0x18c1, 0xada: 0x18ca, 0xadb: 0x18cd, 0xadc: 0x18d0, 0xadd: 0x18d3, + 0xade: 0x18d6, 0xadf: 0x18d9, 0xae0: 0x0313, 0xae1: 0x031b, 0xae2: 0x031f, 0xae3: 0x0327, + 0xae4: 0x032b, 0xae5: 0x032f, 0xae6: 0x0337, 0xae7: 0x033f, 0xae8: 0x0343, 0xae9: 0x034b, + 0xaea: 0x034f, 0xaeb: 0x0353, 0xaec: 0x0357, 0xaed: 0x035b, 0xaee: 0x2e18, 0xaef: 0x2e20, + 0xaf0: 0x2e28, 0xaf1: 0x2e30, 0xaf2: 0x2e38, 0xaf3: 0x2e40, 0xaf4: 0x2e48, 0xaf5: 0x2e50, + 0xaf6: 0x2e60, 0xaf7: 0x2e68, 0xaf8: 0x2e70, 0xaf9: 0x2e78, 0xafa: 0x2e80, 0xafb: 0x2e88, + 0xafc: 0x2ed3, 0xafd: 0x2e9b, 0xafe: 0x2e58, + // Block 0x2c, offset 0xb00 + 0xb00: 0x06bf, 0xb01: 0x071b, 0xb02: 0x06cb, 0xb03: 0x097b, 0xb04: 0x071f, 0xb05: 0x07af, + 0xb06: 0x06c7, 0xb07: 0x07ab, 0xb08: 0x070b, 0xb09: 0x0887, 0xb0a: 0x0d07, 0xb0b: 0x0e8f, + 0xb0c: 0x0dd7, 0xb0d: 0x0d1b, 0xb0e: 0x145f, 0xb0f: 0x098b, 0xb10: 0x0ccf, 0xb11: 0x0d4b, + 0xb12: 0x0d0b, 0xb13: 0x104b, 0xb14: 0x08fb, 0xb15: 0x0f03, 0xb16: 0x1387, 0xb17: 0x105f, + 0xb18: 0x0843, 0xb19: 0x108f, 0xb1a: 0x0f9b, 0xb1b: 0x0a17, 0xb1c: 0x140f, 0xb1d: 0x077f, + 0xb1e: 0x08ab, 0xb1f: 0x0df7, 0xb20: 0x1527, 0xb21: 0x0743, 0xb22: 0x07d3, 0xb23: 0x0d9b, + 0xb24: 0x06cf, 0xb25: 0x06e7, 0xb26: 0x06d3, 0xb27: 0x0adb, 0xb28: 0x08ef, 0xb29: 0x087f, + 0xb2a: 0x0a57, 0xb2b: 0x0a4b, 0xb2c: 0x0feb, 0xb2d: 0x073f, 0xb2e: 0x139b, 0xb2f: 0x089b, + 0xb30: 0x09f3, 0xb31: 0x18dc, 0xb32: 0x18df, 0xb33: 0x18e2, 0xb34: 0x18e5, 0xb35: 0x18ee, + 0xb36: 0x18f1, 0xb37: 0x18f4, 0xb38: 0x18f7, 0xb39: 0x18fa, 0xb3a: 0x18fd, 0xb3b: 0x1900, + 0xb3c: 0x1903, 0xb3d: 0x1906, 0xb3e: 0x1909, 0xb3f: 0x1912, + // Block 0x2d, offset 0xb40 + 0xb40: 0x1cc6, 0xb41: 0x1cd5, 0xb42: 0x1ce4, 0xb43: 0x1cf3, 0xb44: 0x1d02, 0xb45: 0x1d11, + 0xb46: 0x1d20, 0xb47: 0x1d2f, 0xb48: 0x1d3e, 0xb49: 0x218c, 0xb4a: 0x219e, 0xb4b: 0x21b0, + 0xb4c: 0x1954, 0xb4d: 0x1c04, 0xb4e: 0x19d2, 0xb4f: 0x1ba8, 0xb50: 0x04cb, 0xb51: 0x04d3, + 0xb52: 0x04db, 0xb53: 0x04e3, 0xb54: 0x04eb, 0xb55: 0x04ef, 0xb56: 0x04f3, 0xb57: 0x04f7, + 0xb58: 0x04fb, 0xb59: 0x04ff, 0xb5a: 0x0503, 0xb5b: 0x0507, 0xb5c: 0x050b, 0xb5d: 0x050f, + 0xb5e: 0x0513, 0xb5f: 0x0517, 0xb60: 0x051b, 0xb61: 0x0523, 0xb62: 0x0527, 0xb63: 0x052b, + 0xb64: 0x052f, 0xb65: 0x0533, 0xb66: 0x0537, 0xb67: 0x053b, 0xb68: 0x053f, 0xb69: 0x0543, + 0xb6a: 0x0547, 0xb6b: 0x054b, 0xb6c: 0x054f, 0xb6d: 0x0553, 0xb6e: 0x0557, 0xb6f: 0x055b, + 0xb70: 0x055f, 0xb71: 0x0563, 0xb72: 0x0567, 0xb73: 0x056f, 0xb74: 0x0577, 0xb75: 0x057f, + 0xb76: 0x0583, 0xb77: 0x0587, 0xb78: 0x058b, 0xb79: 0x058f, 0xb7a: 0x0593, 0xb7b: 0x0597, + 0xb7c: 0x059b, 0xb7d: 0x059f, 0xb7e: 0x05a3, + // Block 0x2e, offset 0xb80 + 0xb80: 0x2b0c, 0xb81: 0x29a8, 0xb82: 0x2b1c, 0xb83: 0x2880, 0xb84: 0x2ee4, 0xb85: 0x288a, + 0xb86: 0x2894, 0xb87: 0x2f28, 0xb88: 0x29b5, 0xb89: 0x289e, 0xb8a: 0x28a8, 0xb8b: 0x28b2, + 0xb8c: 0x29dc, 0xb8d: 0x29e9, 0xb8e: 0x29c2, 0xb8f: 0x29cf, 0xb90: 0x2ea9, 0xb91: 0x29f6, + 0xb92: 0x2a03, 0xb93: 0x2bbe, 0xb94: 0x26bb, 0xb95: 0x2bd1, 0xb96: 0x2be4, 0xb97: 0x2b2c, + 0xb98: 0x2a10, 0xb99: 0x2bf7, 0xb9a: 0x2c0a, 0xb9b: 0x2a1d, 0xb9c: 0x28bc, 0xb9d: 0x28c6, + 0xb9e: 0x2eb7, 0xb9f: 0x2a2a, 0xba0: 0x2b3c, 0xba1: 0x2ef5, 0xba2: 0x28d0, 0xba3: 0x28da, + 0xba4: 0x2a37, 0xba5: 0x28e4, 0xba6: 0x28ee, 0xba7: 0x26d0, 0xba8: 0x26d7, 0xba9: 0x28f8, + 0xbaa: 0x2902, 0xbab: 0x2c1d, 0xbac: 0x2a44, 0xbad: 0x2b4c, 0xbae: 0x2c30, 0xbaf: 0x2a51, + 0xbb0: 0x2916, 0xbb1: 0x290c, 0xbb2: 0x2f3c, 0xbb3: 0x2a5e, 0xbb4: 0x2c43, 0xbb5: 0x2920, + 0xbb6: 0x2b5c, 0xbb7: 0x292a, 0xbb8: 0x2a78, 0xbb9: 0x2934, 0xbba: 0x2a85, 0xbbb: 0x2f06, + 0xbbc: 0x2a6b, 0xbbd: 0x2b6c, 0xbbe: 0x2a92, 0xbbf: 0x26de, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2f17, 0xbc1: 0x293e, 0xbc2: 0x2948, 0xbc3: 0x2a9f, 0xbc4: 0x2952, 0xbc5: 0x295c, + 0xbc6: 0x2966, 0xbc7: 0x2b7c, 0xbc8: 0x2aac, 0xbc9: 0x26e5, 0xbca: 0x2c56, 0xbcb: 0x2e90, + 0xbcc: 0x2b8c, 0xbcd: 0x2ab9, 0xbce: 0x2ec5, 0xbcf: 0x2970, 0xbd0: 0x297a, 0xbd1: 0x2ac6, + 0xbd2: 0x26ec, 0xbd3: 0x2ad3, 0xbd4: 0x2b9c, 0xbd5: 0x26f3, 0xbd6: 0x2c69, 0xbd7: 0x2984, + 0xbd8: 0x1cb7, 0xbd9: 0x1ccb, 0xbda: 0x1cda, 0xbdb: 0x1ce9, 0xbdc: 0x1cf8, 0xbdd: 0x1d07, + 0xbde: 0x1d16, 0xbdf: 0x1d25, 0xbe0: 0x1d34, 0xbe1: 0x1d43, 0xbe2: 0x2192, 0xbe3: 0x21a4, + 0xbe4: 0x21b6, 0xbe5: 0x21c2, 0xbe6: 0x21ce, 0xbe7: 0x21da, 0xbe8: 0x21e6, 0xbe9: 0x21f2, + 0xbea: 0x21fe, 0xbeb: 0x220a, 0xbec: 0x2246, 0xbed: 0x2252, 0xbee: 0x225e, 0xbef: 0x226a, + 0xbf0: 0x2276, 0xbf1: 0x1c14, 0xbf2: 0x19c6, 0xbf3: 0x1936, 0xbf4: 0x1be4, 0xbf5: 0x1a47, + 0xbf6: 0x1a56, 0xbf7: 0x19cc, 0xbf8: 0x1bfc, 0xbf9: 0x1c00, 0xbfa: 0x1960, 0xbfb: 0x2701, + 0xbfc: 0x270f, 0xbfd: 0x26fa, 0xbfe: 0x2708, 0xbff: 0x2ae0, + // Block 0x30, offset 0xc00 + 0xc00: 0x1a4a, 0xc01: 0x1a32, 0xc02: 0x1c60, 0xc03: 0x1a1a, 0xc04: 0x19f3, 0xc05: 0x1969, + 0xc06: 0x1978, 0xc07: 0x1948, 0xc08: 0x1bf0, 0xc09: 0x1d52, 0xc0a: 0x1a4d, 0xc0b: 0x1a35, + 0xc0c: 0x1c64, 0xc0d: 0x1c70, 0xc0e: 0x1a26, 0xc0f: 0x19fc, 0xc10: 0x1957, 0xc11: 0x1c1c, + 0xc12: 0x1bb0, 0xc13: 0x1b9c, 0xc14: 0x1bcc, 0xc15: 0x1c74, 0xc16: 0x1a29, 0xc17: 0x19c9, + 0xc18: 0x19ff, 0xc19: 0x19de, 0xc1a: 0x1a41, 0xc1b: 0x1c78, 0xc1c: 0x1a2c, 0xc1d: 0x19c0, + 0xc1e: 0x1a02, 0xc1f: 0x1c3c, 0xc20: 0x1bf4, 0xc21: 0x1a14, 0xc22: 0x1c24, 0xc23: 0x1c40, + 0xc24: 0x1bf8, 0xc25: 0x1a17, 0xc26: 0x1c28, 0xc27: 0x22e8, 0xc28: 0x22fc, 0xc29: 0x1996, + 0xc2a: 0x1c20, 0xc2b: 0x1bb4, 0xc2c: 0x1ba0, 0xc2d: 0x1c48, 0xc2e: 0x2716, 0xc2f: 0x27ad, + 0xc30: 0x1a59, 0xc31: 0x1a44, 0xc32: 0x1c7c, 0xc33: 0x1a2f, 0xc34: 0x1a50, 0xc35: 0x1a38, + 0xc36: 0x1c68, 0xc37: 0x1a1d, 0xc38: 0x19f6, 0xc39: 0x1981, 0xc3a: 0x1a53, 0xc3b: 0x1a3b, + 0xc3c: 0x1c6c, 0xc3d: 0x1a20, 0xc3e: 0x19f9, 0xc3f: 0x1984, + // Block 0x31, offset 0xc40 + 0xc40: 0x1c2c, 0xc41: 0x1bb8, 0xc42: 0x1d4d, 0xc43: 0x1939, 0xc44: 0x19ba, 0xc45: 0x19bd, + 0xc46: 0x22f5, 0xc47: 0x1b94, 0xc48: 0x19c3, 0xc49: 0x194b, 0xc4a: 0x19e1, 0xc4b: 0x194e, + 0xc4c: 0x19ea, 0xc4d: 0x196c, 0xc4e: 0x196f, 0xc4f: 0x1a05, 0xc50: 0x1a0b, 0xc51: 0x1a0e, + 0xc52: 0x1c30, 0xc53: 0x1a11, 0xc54: 0x1a23, 0xc55: 0x1c38, 0xc56: 0x1c44, 0xc57: 0x1990, + 0xc58: 0x1d57, 0xc59: 0x1bbc, 0xc5a: 0x1993, 0xc5b: 0x1a5c, 0xc5c: 0x19a5, 0xc5d: 0x19b4, + 0xc5e: 0x22e2, 0xc5f: 0x22dc, 0xc60: 0x1cc1, 0xc61: 0x1cd0, 0xc62: 0x1cdf, 0xc63: 0x1cee, + 0xc64: 0x1cfd, 0xc65: 0x1d0c, 0xc66: 0x1d1b, 0xc67: 0x1d2a, 0xc68: 0x1d39, 0xc69: 0x2186, + 0xc6a: 0x2198, 0xc6b: 0x21aa, 0xc6c: 0x21bc, 0xc6d: 0x21c8, 0xc6e: 0x21d4, 0xc6f: 0x21e0, + 0xc70: 0x21ec, 0xc71: 0x21f8, 0xc72: 0x2204, 0xc73: 0x2240, 0xc74: 0x224c, 0xc75: 0x2258, + 0xc76: 0x2264, 0xc77: 0x2270, 0xc78: 0x227c, 0xc79: 0x2282, 0xc7a: 0x2288, 0xc7b: 0x228e, + 0xc7c: 0x2294, 0xc7d: 0x22a6, 0xc7e: 0x22ac, 0xc7f: 0x1c10, + // Block 0x32, offset 0xc80 + 0xc80: 0x1377, 0xc81: 0x0cfb, 0xc82: 0x13d3, 0xc83: 0x139f, 0xc84: 0x0e57, 0xc85: 0x06eb, + 0xc86: 0x08df, 0xc87: 0x162b, 0xc88: 0x162b, 0xc89: 0x0a0b, 0xc8a: 0x145f, 0xc8b: 0x0943, + 0xc8c: 0x0a07, 0xc8d: 0x0bef, 0xc8e: 0x0fcf, 0xc8f: 0x115f, 0xc90: 0x1297, 0xc91: 0x12d3, + 0xc92: 0x1307, 0xc93: 0x141b, 0xc94: 0x0d73, 0xc95: 0x0dff, 0xc96: 0x0eab, 0xc97: 0x0f43, + 0xc98: 0x125f, 0xc99: 0x1447, 0xc9a: 0x1573, 0xc9b: 0x070f, 0xc9c: 0x08b3, 0xc9d: 0x0d87, + 0xc9e: 0x0ecf, 0xc9f: 0x1293, 0xca0: 0x15c3, 0xca1: 0x0ab3, 0xca2: 0x0e77, 0xca3: 0x1283, + 0xca4: 0x1317, 0xca5: 0x0c23, 0xca6: 0x11bb, 0xca7: 0x12df, 0xca8: 0x0b1f, 0xca9: 0x0d0f, + 0xcaa: 0x0e17, 0xcab: 0x0f1b, 0xcac: 0x1427, 0xcad: 0x074f, 0xcae: 0x07e7, 0xcaf: 0x0853, + 0xcb0: 0x0c8b, 0xcb1: 0x0d7f, 0xcb2: 0x0ecb, 0xcb3: 0x0fef, 0xcb4: 0x1177, 0xcb5: 0x128b, + 0xcb6: 0x12a3, 0xcb7: 0x13c7, 0xcb8: 0x14ef, 0xcb9: 0x15a3, 0xcba: 0x15bf, 0xcbb: 0x102b, + 0xcbc: 0x106b, 0xcbd: 0x1123, 0xcbe: 0x1243, 0xcbf: 0x147b, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x15cb, 0xcc1: 0x134b, 0xcc2: 0x09c7, 0xcc3: 0x0b3b, 0xcc4: 0x10db, 0xcc5: 0x119b, + 0xcc6: 0x0eff, 0xcc7: 0x1033, 0xcc8: 0x1397, 0xcc9: 0x14e7, 0xcca: 0x09c3, 0xccb: 0x0a8f, + 0xccc: 0x0d77, 0xccd: 0x0e2b, 0xcce: 0x0e5f, 0xccf: 0x1113, 0xcd0: 0x113b, 0xcd1: 0x14a7, + 0xcd2: 0x084f, 0xcd3: 0x11a7, 0xcd4: 0x07f3, 0xcd5: 0x07ef, 0xcd6: 0x1097, 0xcd7: 0x1127, + 0xcd8: 0x125b, 0xcd9: 0x14af, 0xcda: 0x1367, 0xcdb: 0x0c27, 0xcdc: 0x0d73, 0xcdd: 0x1357, + 0xcde: 0x06f7, 0xcdf: 0x0a63, 0xce0: 0x0b93, 0xce1: 0x0f2f, 0xce2: 0x0faf, 0xce3: 0x0873, + 0xce4: 0x103b, 0xce5: 0x075f, 0xce6: 0x0b77, 0xce7: 0x06d7, 0xce8: 0x0deb, 0xce9: 0x0ca3, + 0xcea: 0x110f, 0xceb: 0x08c7, 0xcec: 0x09b3, 0xced: 0x0ffb, 0xcee: 0x1263, 0xcef: 0x133b, + 0xcf0: 0x0db7, 0xcf1: 0x13f7, 0xcf2: 0x0de3, 0xcf3: 0x0c37, 0xcf4: 0x121b, 0xcf5: 0x0c57, + 0xcf6: 0x0fab, 0xcf7: 0x072b, 0xcf8: 0x07a7, 0xcf9: 0x07eb, 0xcfa: 0x0d53, 0xcfb: 0x10fb, + 0xcfc: 0x11f3, 0xcfd: 0x1347, 0xcfe: 0x145b, 0xcff: 0x085b, + // Block 0x34, offset 0xd00 + 0xd00: 0x090f, 0xd01: 0x0a17, 0xd02: 0x0b2f, 0xd03: 0x0cbf, 0xd04: 0x0e7b, 0xd05: 0x103f, + 0xd06: 0x1497, 0xd07: 0x157b, 0xd08: 0x15cf, 0xd09: 0x15e7, 0xd0a: 0x0837, 0xd0b: 0x0cf3, + 0xd0c: 0x0da3, 0xd0d: 0x13eb, 0xd0e: 0x0afb, 0xd0f: 0x0bd7, 0xd10: 0x0bf3, 0xd11: 0x0c83, + 0xd12: 0x0e6b, 0xd13: 0x0eb7, 0xd14: 0x0f67, 0xd15: 0x108b, 0xd16: 0x112f, 0xd17: 0x1193, + 0xd18: 0x13db, 0xd19: 0x126b, 0xd1a: 0x1403, 0xd1b: 0x147f, 0xd1c: 0x080f, 0xd1d: 0x083b, + 0xd1e: 0x0923, 0xd1f: 0x0ea7, 0xd20: 0x12f3, 0xd21: 0x133b, 0xd22: 0x0b1b, 0xd23: 0x0b8b, + 0xd24: 0x0c4f, 0xd25: 0x0daf, 0xd26: 0x10d7, 0xd27: 0x0f23, 0xd28: 0x073b, 0xd29: 0x097f, + 0xd2a: 0x0a63, 0xd2b: 0x0ac7, 0xd2c: 0x0b97, 0xd2d: 0x0f3f, 0xd2e: 0x0f5b, 0xd2f: 0x116b, + 0xd30: 0x118b, 0xd31: 0x1463, 0xd32: 0x14e3, 0xd33: 0x14f3, 0xd34: 0x152f, 0xd35: 0x0753, + 0xd36: 0x107f, 0xd37: 0x144f, 0xd38: 0x14cb, 0xd39: 0x0baf, 0xd3a: 0x0717, 0xd3b: 0x0777, + 0xd3c: 0x0a67, 0xd3d: 0x0a87, 0xd3e: 0x0caf, 0xd3f: 0x0d73, + // Block 0x35, offset 0xd40 + 0xd40: 0x0ec3, 0xd41: 0x0fcb, 0xd42: 0x1277, 0xd43: 0x1417, 0xd44: 0x1623, 0xd45: 0x0ce3, + 0xd46: 0x14a3, 0xd47: 0x0833, 0xd48: 0x0d2f, 0xd49: 0x0d3b, 0xd4a: 0x0e0f, 0xd4b: 0x0e47, + 0xd4c: 0x0f4b, 0xd4d: 0x0fa7, 0xd4e: 0x1027, 0xd4f: 0x110b, 0xd50: 0x153b, 0xd51: 0x07af, + 0xd52: 0x0c03, 0xd53: 0x14b3, 0xd54: 0x0767, 0xd55: 0x0aab, 0xd56: 0x0e2f, 0xd57: 0x13df, + 0xd58: 0x0b67, 0xd59: 0x0bb7, 0xd5a: 0x0d43, 0xd5b: 0x0f2f, 0xd5c: 0x14bb, 0xd5d: 0x0817, + 0xd5e: 0x08ff, 0xd5f: 0x0a97, 0xd60: 0x0cd3, 0xd61: 0x0d1f, 0xd62: 0x0d5f, 0xd63: 0x0df3, + 0xd64: 0x0f47, 0xd65: 0x0fbb, 0xd66: 0x1157, 0xd67: 0x12f7, 0xd68: 0x1303, 0xd69: 0x1457, + 0xd6a: 0x14d7, 0xd6b: 0x0883, 0xd6c: 0x0e4b, 0xd6d: 0x0903, 0xd6e: 0x0ec7, 0xd6f: 0x0f6b, + 0xd70: 0x1287, 0xd71: 0x14bf, 0xd72: 0x15ab, 0xd73: 0x15d3, 0xd74: 0x0d37, 0xd75: 0x0e27, + 0xd76: 0x11c3, 0xd77: 0x10b7, 0xd78: 0x10c3, 0xd79: 0x10e7, 0xd7a: 0x0f17, 0xd7b: 0x0e9f, + 0xd7c: 0x1363, 0xd7d: 0x0733, 0xd7e: 0x122b, 0xd7f: 0x081b, + // Block 0x36, offset 0xd80 + 0xd80: 0x080b, 0xd81: 0x0b0b, 0xd82: 0x0c2b, 0xd83: 0x10f3, 0xd84: 0x0a53, 0xd85: 0x0e03, + 0xd86: 0x0cef, 0xd87: 0x13e7, 0xd88: 0x12e7, 0xd89: 0x14ab, 0xd8a: 0x1323, 0xd8b: 0x0b27, + 0xd8c: 0x0787, 0xd8d: 0x095b, 0xd90: 0x09af, + 0xd92: 0x0cdf, 0xd95: 0x07f7, 0xd96: 0x0f1f, 0xd97: 0x0fe3, + 0xd98: 0x1047, 0xd99: 0x1063, 0xd9a: 0x1067, 0xd9b: 0x107b, 0xd9c: 0x14fb, 0xd9d: 0x10eb, + 0xd9e: 0x116f, 0xda0: 0x128f, 0xda2: 0x1353, + 0xda5: 0x1407, 0xda6: 0x1433, + 0xdaa: 0x154f, 0xdab: 0x1553, 0xdac: 0x1557, 0xdad: 0x15bb, 0xdae: 0x142b, 0xdaf: 0x14c7, + 0xdb0: 0x0757, 0xdb1: 0x077b, 0xdb2: 0x078f, 0xdb3: 0x084b, 0xdb4: 0x0857, 0xdb5: 0x0897, + 0xdb6: 0x094b, 0xdb7: 0x0967, 0xdb8: 0x096f, 0xdb9: 0x09ab, 0xdba: 0x09b7, 0xdbb: 0x0a93, + 0xdbc: 0x0a9b, 0xdbd: 0x0ba3, 0xdbe: 0x0bcb, 0xdbf: 0x0bd3, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0beb, 0xdc1: 0x0c97, 0xdc2: 0x0cc7, 0xdc3: 0x0ce7, 0xdc4: 0x0d57, 0xdc5: 0x0e1b, + 0xdc6: 0x0e37, 0xdc7: 0x0e67, 0xdc8: 0x0ebb, 0xdc9: 0x0edb, 0xdca: 0x0f4f, 0xdcb: 0x102f, + 0xdcc: 0x104b, 0xdcd: 0x1053, 0xdce: 0x104f, 0xdcf: 0x1057, 0xdd0: 0x105b, 0xdd1: 0x105f, + 0xdd2: 0x1073, 0xdd3: 0x1077, 0xdd4: 0x109b, 0xdd5: 0x10af, 0xdd6: 0x10cb, 0xdd7: 0x112f, + 0xdd8: 0x1137, 0xdd9: 0x113f, 0xdda: 0x1153, 0xddb: 0x117b, 0xddc: 0x11cb, 0xddd: 0x11ff, + 0xdde: 0x11ff, 0xddf: 0x1267, 0xde0: 0x130f, 0xde1: 0x1327, 0xde2: 0x135b, 0xde3: 0x135f, + 0xde4: 0x13a3, 0xde5: 0x13a7, 0xde6: 0x13ff, 0xde7: 0x1407, 0xde8: 0x14db, 0xde9: 0x151f, + 0xdea: 0x1537, 0xdeb: 0x0b9b, 0xdec: 0x171e, 0xded: 0x11e3, + 0xdf0: 0x06df, 0xdf1: 0x07e3, 0xdf2: 0x07a3, 0xdf3: 0x074b, 0xdf4: 0x078b, 0xdf5: 0x07b7, + 0xdf6: 0x0847, 0xdf7: 0x0863, 0xdf8: 0x094b, 0xdf9: 0x0937, 0xdfa: 0x0947, 0xdfb: 0x0963, + 0xdfc: 0x09af, 0xdfd: 0x09bf, 0xdfe: 0x0a03, 0xdff: 0x0a0f, + // Block 0x38, offset 0xe00 + 0xe00: 0x0a2b, 0xe01: 0x0a3b, 0xe02: 0x0b23, 0xe03: 0x0b2b, 0xe04: 0x0b5b, 0xe05: 0x0b7b, + 0xe06: 0x0bab, 0xe07: 0x0bc3, 0xe08: 0x0bb3, 0xe09: 0x0bd3, 0xe0a: 0x0bc7, 0xe0b: 0x0beb, + 0xe0c: 0x0c07, 0xe0d: 0x0c5f, 0xe0e: 0x0c6b, 0xe0f: 0x0c73, 0xe10: 0x0c9b, 0xe11: 0x0cdf, + 0xe12: 0x0d0f, 0xe13: 0x0d13, 0xe14: 0x0d27, 0xe15: 0x0da7, 0xe16: 0x0db7, 0xe17: 0x0e0f, + 0xe18: 0x0e5b, 0xe19: 0x0e53, 0xe1a: 0x0e67, 0xe1b: 0x0e83, 0xe1c: 0x0ebb, 0xe1d: 0x1013, + 0xe1e: 0x0edf, 0xe1f: 0x0f13, 0xe20: 0x0f1f, 0xe21: 0x0f5f, 0xe22: 0x0f7b, 0xe23: 0x0f9f, + 0xe24: 0x0fc3, 0xe25: 0x0fc7, 0xe26: 0x0fe3, 0xe27: 0x0fe7, 0xe28: 0x0ff7, 0xe29: 0x100b, + 0xe2a: 0x1007, 0xe2b: 0x1037, 0xe2c: 0x10b3, 0xe2d: 0x10cb, 0xe2e: 0x10e3, 0xe2f: 0x111b, + 0xe30: 0x112f, 0xe31: 0x114b, 0xe32: 0x117b, 0xe33: 0x122f, 0xe34: 0x1257, 0xe35: 0x12cb, + 0xe36: 0x1313, 0xe37: 0x131f, 0xe38: 0x1327, 0xe39: 0x133f, 0xe3a: 0x1353, 0xe3b: 0x1343, + 0xe3c: 0x135b, 0xe3d: 0x1357, 0xe3e: 0x134f, 0xe3f: 0x135f, + // Block 0x39, offset 0xe40 + 0xe40: 0x136b, 0xe41: 0x13a7, 0xe42: 0x13e3, 0xe43: 0x1413, 0xe44: 0x144b, 0xe45: 0x146b, + 0xe46: 0x14b7, 0xe47: 0x14db, 0xe48: 0x14fb, 0xe49: 0x150f, 0xe4a: 0x151f, 0xe4b: 0x152b, + 0xe4c: 0x1537, 0xe4d: 0x158b, 0xe4e: 0x162b, 0xe4f: 0x16b5, 0xe50: 0x16b0, 0xe51: 0x16e2, + 0xe52: 0x0607, 0xe53: 0x062f, 0xe54: 0x0633, 0xe55: 0x1764, 0xe56: 0x1791, 0xe57: 0x1809, + 0xe58: 0x1617, 0xe59: 0x1627, + // Block 0x3a, offset 0xe80 + 0xe80: 0x19d5, 0xe81: 0x19d8, 0xe82: 0x19db, 0xe83: 0x1c08, 0xe84: 0x1c0c, 0xe85: 0x1a5f, + 0xe86: 0x1a5f, + 0xe93: 0x1d75, 0xe94: 0x1d66, 0xe95: 0x1d6b, 0xe96: 0x1d7a, 0xe97: 0x1d70, + 0xe9d: 0x4390, + 0xe9e: 0x8115, 0xe9f: 0x4402, 0xea0: 0x022d, 0xea1: 0x0215, 0xea2: 0x021e, 0xea3: 0x0221, + 0xea4: 0x0224, 0xea5: 0x0227, 0xea6: 0x022a, 0xea7: 0x0230, 0xea8: 0x0233, 0xea9: 0x0017, + 0xeaa: 0x43f0, 0xeab: 0x43f6, 0xeac: 0x44f4, 0xead: 0x44fc, 0xeae: 0x4348, 0xeaf: 0x434e, + 0xeb0: 0x4354, 0xeb1: 0x435a, 0xeb2: 0x4366, 0xeb3: 0x436c, 0xeb4: 0x4372, 0xeb5: 0x437e, + 0xeb6: 0x4384, 0xeb8: 0x438a, 0xeb9: 0x4396, 0xeba: 0x439c, 0xebb: 0x43a2, + 0xebc: 0x43ae, 0xebe: 0x43b4, + // Block 0x3b, offset 0xec0 + 0xec0: 0x43ba, 0xec1: 0x43c0, 0xec3: 0x43c6, 0xec4: 0x43cc, + 0xec6: 0x43d8, 0xec7: 0x43de, 0xec8: 0x43e4, 0xec9: 0x43ea, 0xeca: 0x43fc, 0xecb: 0x4378, + 0xecc: 0x4360, 0xecd: 0x43a8, 0xece: 0x43d2, 0xecf: 0x1d7f, 0xed0: 0x0299, 0xed1: 0x0299, + 0xed2: 0x02a2, 0xed3: 0x02a2, 0xed4: 0x02a2, 0xed5: 0x02a2, 0xed6: 0x02a5, 0xed7: 0x02a5, + 0xed8: 0x02a5, 0xed9: 0x02a5, 0xeda: 0x02ab, 0xedb: 0x02ab, 0xedc: 0x02ab, 0xedd: 0x02ab, + 0xede: 0x029f, 0xedf: 0x029f, 0xee0: 0x029f, 0xee1: 0x029f, 0xee2: 0x02a8, 0xee3: 0x02a8, + 0xee4: 0x02a8, 0xee5: 0x02a8, 0xee6: 0x029c, 0xee7: 0x029c, 0xee8: 0x029c, 0xee9: 0x029c, + 0xeea: 0x02cf, 0xeeb: 0x02cf, 0xeec: 0x02cf, 0xeed: 0x02cf, 0xeee: 0x02d2, 0xeef: 0x02d2, + 0xef0: 0x02d2, 0xef1: 0x02d2, 0xef2: 0x02b1, 0xef3: 0x02b1, 0xef4: 0x02b1, 0xef5: 0x02b1, + 0xef6: 0x02ae, 0xef7: 0x02ae, 0xef8: 0x02ae, 0xef9: 0x02ae, 0xefa: 0x02b4, 0xefb: 0x02b4, + 0xefc: 0x02b4, 0xefd: 0x02b4, 0xefe: 0x02b7, 0xeff: 0x02b7, + // Block 0x3c, offset 0xf00 + 0xf00: 0x02b7, 0xf01: 0x02b7, 0xf02: 0x02c0, 0xf03: 0x02c0, 0xf04: 0x02bd, 0xf05: 0x02bd, + 0xf06: 0x02c3, 0xf07: 0x02c3, 0xf08: 0x02ba, 0xf09: 0x02ba, 0xf0a: 0x02c9, 0xf0b: 0x02c9, + 0xf0c: 0x02c6, 0xf0d: 0x02c6, 0xf0e: 0x02d5, 0xf0f: 0x02d5, 0xf10: 0x02d5, 0xf11: 0x02d5, + 0xf12: 0x02db, 0xf13: 0x02db, 0xf14: 0x02db, 0xf15: 0x02db, 0xf16: 0x02e1, 0xf17: 0x02e1, + 0xf18: 0x02e1, 0xf19: 0x02e1, 0xf1a: 0x02de, 0xf1b: 0x02de, 0xf1c: 0x02de, 0xf1d: 0x02de, + 0xf1e: 0x02e4, 0xf1f: 0x02e4, 0xf20: 0x02e7, 0xf21: 0x02e7, 0xf22: 0x02e7, 0xf23: 0x02e7, + 0xf24: 0x446e, 0xf25: 0x446e, 0xf26: 0x02ed, 0xf27: 0x02ed, 0xf28: 0x02ed, 0xf29: 0x02ed, + 0xf2a: 0x02ea, 0xf2b: 0x02ea, 0xf2c: 0x02ea, 0xf2d: 0x02ea, 0xf2e: 0x0308, 0xf2f: 0x0308, + 0xf30: 0x4468, 0xf31: 0x4468, + // Block 0x3d, offset 0xf40 + 0xf53: 0x02d8, 0xf54: 0x02d8, 0xf55: 0x02d8, 0xf56: 0x02d8, 0xf57: 0x02f6, + 0xf58: 0x02f6, 0xf59: 0x02f3, 0xf5a: 0x02f3, 0xf5b: 0x02f9, 0xf5c: 0x02f9, 0xf5d: 0x204f, + 0xf5e: 0x02ff, 0xf5f: 0x02ff, 0xf60: 0x02f0, 0xf61: 0x02f0, 0xf62: 0x02fc, 0xf63: 0x02fc, + 0xf64: 0x0305, 0xf65: 0x0305, 0xf66: 0x0305, 0xf67: 0x0305, 0xf68: 0x028d, 0xf69: 0x028d, + 0xf6a: 0x25aa, 0xf6b: 0x25aa, 0xf6c: 0x261a, 0xf6d: 0x261a, 0xf6e: 0x25e9, 0xf6f: 0x25e9, + 0xf70: 0x2605, 0xf71: 0x2605, 0xf72: 0x25fe, 0xf73: 0x25fe, 0xf74: 0x260c, 0xf75: 0x260c, + 0xf76: 0x2613, 0xf77: 0x2613, 0xf78: 0x2613, 0xf79: 0x25f0, 0xf7a: 0x25f0, 0xf7b: 0x25f0, + 0xf7c: 0x0302, 0xf7d: 0x0302, 0xf7e: 0x0302, 0xf7f: 0x0302, + // Block 0x3e, offset 0xf80 + 0xf80: 0x25b1, 0xf81: 0x25b8, 0xf82: 0x25d4, 0xf83: 0x25f0, 0xf84: 0x25f7, 0xf85: 0x1d89, + 0xf86: 0x1d8e, 0xf87: 0x1d93, 0xf88: 0x1da2, 0xf89: 0x1db1, 0xf8a: 0x1db6, 0xf8b: 0x1dbb, + 0xf8c: 0x1dc0, 0xf8d: 0x1dc5, 0xf8e: 0x1dd4, 0xf8f: 0x1de3, 0xf90: 0x1de8, 0xf91: 0x1ded, + 0xf92: 0x1dfc, 0xf93: 0x1e0b, 0xf94: 0x1e10, 0xf95: 0x1e15, 0xf96: 0x1e1a, 0xf97: 0x1e29, + 0xf98: 0x1e2e, 0xf99: 0x1e3d, 0xf9a: 0x1e42, 0xf9b: 0x1e47, 0xf9c: 0x1e56, 0xf9d: 0x1e5b, + 0xf9e: 0x1e60, 0xf9f: 0x1e6a, 0xfa0: 0x1ea6, 0xfa1: 0x1eb5, 0xfa2: 0x1ec4, 0xfa3: 0x1ec9, + 0xfa4: 0x1ece, 0xfa5: 0x1ed8, 0xfa6: 0x1ee7, 0xfa7: 0x1eec, 0xfa8: 0x1efb, 0xfa9: 0x1f00, + 0xfaa: 0x1f05, 0xfab: 0x1f14, 0xfac: 0x1f19, 0xfad: 0x1f28, 0xfae: 0x1f2d, 0xfaf: 0x1f32, + 0xfb0: 0x1f37, 0xfb1: 0x1f3c, 0xfb2: 0x1f41, 0xfb3: 0x1f46, 0xfb4: 0x1f4b, 0xfb5: 0x1f50, + 0xfb6: 0x1f55, 0xfb7: 0x1f5a, 0xfb8: 0x1f5f, 0xfb9: 0x1f64, 0xfba: 0x1f69, 0xfbb: 0x1f6e, + 0xfbc: 0x1f73, 0xfbd: 0x1f78, 0xfbe: 0x1f7d, 0xfbf: 0x1f87, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x1f8c, 0xfc1: 0x1f91, 0xfc2: 0x1f96, 0xfc3: 0x1fa0, 0xfc4: 0x1fa5, 0xfc5: 0x1faf, + 0xfc6: 0x1fb4, 0xfc7: 0x1fb9, 0xfc8: 0x1fbe, 0xfc9: 0x1fc3, 0xfca: 0x1fc8, 0xfcb: 0x1fcd, + 0xfcc: 0x1fd2, 0xfcd: 0x1fd7, 0xfce: 0x1fe6, 0xfcf: 0x1ff5, 0xfd0: 0x1ffa, 0xfd1: 0x1fff, + 0xfd2: 0x2004, 0xfd3: 0x2009, 0xfd4: 0x200e, 0xfd5: 0x2018, 0xfd6: 0x201d, 0xfd7: 0x2022, + 0xfd8: 0x2031, 0xfd9: 0x2040, 0xfda: 0x2045, 0xfdb: 0x4420, 0xfdc: 0x4426, 0xfdd: 0x445c, + 0xfde: 0x44b3, 0xfdf: 0x44ba, 0xfe0: 0x44c1, 0xfe1: 0x44c8, 0xfe2: 0x44cf, 0xfe3: 0x44d6, + 0xfe4: 0x25c6, 0xfe5: 0x25cd, 0xfe6: 0x25d4, 0xfe7: 0x25db, 0xfe8: 0x25f0, 0xfe9: 0x25f7, + 0xfea: 0x1d98, 0xfeb: 0x1d9d, 0xfec: 0x1da2, 0xfed: 0x1da7, 0xfee: 0x1db1, 0xfef: 0x1db6, + 0xff0: 0x1dca, 0xff1: 0x1dcf, 0xff2: 0x1dd4, 0xff3: 0x1dd9, 0xff4: 0x1de3, 0xff5: 0x1de8, + 0xff6: 0x1df2, 0xff7: 0x1df7, 0xff8: 0x1dfc, 0xff9: 0x1e01, 0xffa: 0x1e0b, 0xffb: 0x1e10, + 0xffc: 0x1f3c, 0xffd: 0x1f41, 0xffe: 0x1f50, 0xfff: 0x1f55, + // Block 0x40, offset 0x1000 + 0x1000: 0x1f5a, 0x1001: 0x1f6e, 0x1002: 0x1f73, 0x1003: 0x1f78, 0x1004: 0x1f7d, 0x1005: 0x1f96, + 0x1006: 0x1fa0, 0x1007: 0x1fa5, 0x1008: 0x1faa, 0x1009: 0x1fbe, 0x100a: 0x1fdc, 0x100b: 0x1fe1, + 0x100c: 0x1fe6, 0x100d: 0x1feb, 0x100e: 0x1ff5, 0x100f: 0x1ffa, 0x1010: 0x445c, 0x1011: 0x2027, + 0x1012: 0x202c, 0x1013: 0x2031, 0x1014: 0x2036, 0x1015: 0x2040, 0x1016: 0x2045, 0x1017: 0x25b1, + 0x1018: 0x25b8, 0x1019: 0x25bf, 0x101a: 0x25d4, 0x101b: 0x25e2, 0x101c: 0x1d89, 0x101d: 0x1d8e, + 0x101e: 0x1d93, 0x101f: 0x1da2, 0x1020: 0x1dac, 0x1021: 0x1dbb, 0x1022: 0x1dc0, 0x1023: 0x1dc5, + 0x1024: 0x1dd4, 0x1025: 0x1dde, 0x1026: 0x1dfc, 0x1027: 0x1e15, 0x1028: 0x1e1a, 0x1029: 0x1e29, + 0x102a: 0x1e2e, 0x102b: 0x1e3d, 0x102c: 0x1e47, 0x102d: 0x1e56, 0x102e: 0x1e5b, 0x102f: 0x1e60, + 0x1030: 0x1e6a, 0x1031: 0x1ea6, 0x1032: 0x1eab, 0x1033: 0x1eb5, 0x1034: 0x1ec4, 0x1035: 0x1ec9, + 0x1036: 0x1ece, 0x1037: 0x1ed8, 0x1038: 0x1ee7, 0x1039: 0x1efb, 0x103a: 0x1f00, 0x103b: 0x1f05, + 0x103c: 0x1f14, 0x103d: 0x1f19, 0x103e: 0x1f28, 0x103f: 0x1f2d, + // Block 0x41, offset 0x1040 + 0x1040: 0x1f32, 0x1041: 0x1f37, 0x1042: 0x1f46, 0x1043: 0x1f4b, 0x1044: 0x1f5f, 0x1045: 0x1f64, + 0x1046: 0x1f69, 0x1047: 0x1f6e, 0x1048: 0x1f73, 0x1049: 0x1f87, 0x104a: 0x1f8c, 0x104b: 0x1f91, + 0x104c: 0x1f96, 0x104d: 0x1f9b, 0x104e: 0x1faf, 0x104f: 0x1fb4, 0x1050: 0x1fb9, 0x1051: 0x1fbe, + 0x1052: 0x1fcd, 0x1053: 0x1fd2, 0x1054: 0x1fd7, 0x1055: 0x1fe6, 0x1056: 0x1ff0, 0x1057: 0x1fff, + 0x1058: 0x2004, 0x1059: 0x4450, 0x105a: 0x2018, 0x105b: 0x201d, 0x105c: 0x2022, 0x105d: 0x2031, + 0x105e: 0x203b, 0x105f: 0x25d4, 0x1060: 0x25e2, 0x1061: 0x1da2, 0x1062: 0x1dac, 0x1063: 0x1dd4, + 0x1064: 0x1dde, 0x1065: 0x1dfc, 0x1066: 0x1e06, 0x1067: 0x1e6a, 0x1068: 0x1e6f, 0x1069: 0x1e92, + 0x106a: 0x1e97, 0x106b: 0x1f6e, 0x106c: 0x1f73, 0x106d: 0x1f96, 0x106e: 0x1fe6, 0x106f: 0x1ff0, + 0x1070: 0x2031, 0x1071: 0x203b, 0x1072: 0x4504, 0x1073: 0x450c, 0x1074: 0x4514, 0x1075: 0x1ef1, + 0x1076: 0x1ef6, 0x1077: 0x1f0a, 0x1078: 0x1f0f, 0x1079: 0x1f1e, 0x107a: 0x1f23, 0x107b: 0x1e74, + 0x107c: 0x1e79, 0x107d: 0x1e9c, 0x107e: 0x1ea1, 0x107f: 0x1e33, + // Block 0x42, offset 0x1080 + 0x1080: 0x1e38, 0x1081: 0x1e1f, 0x1082: 0x1e24, 0x1083: 0x1e4c, 0x1084: 0x1e51, 0x1085: 0x1eba, + 0x1086: 0x1ebf, 0x1087: 0x1edd, 0x1088: 0x1ee2, 0x1089: 0x1e7e, 0x108a: 0x1e83, 0x108b: 0x1e88, + 0x108c: 0x1e92, 0x108d: 0x1e8d, 0x108e: 0x1e65, 0x108f: 0x1eb0, 0x1090: 0x1ed3, 0x1091: 0x1ef1, + 0x1092: 0x1ef6, 0x1093: 0x1f0a, 0x1094: 0x1f0f, 0x1095: 0x1f1e, 0x1096: 0x1f23, 0x1097: 0x1e74, + 0x1098: 0x1e79, 0x1099: 0x1e9c, 0x109a: 0x1ea1, 0x109b: 0x1e33, 0x109c: 0x1e38, 0x109d: 0x1e1f, + 0x109e: 0x1e24, 0x109f: 0x1e4c, 0x10a0: 0x1e51, 0x10a1: 0x1eba, 0x10a2: 0x1ebf, 0x10a3: 0x1edd, + 0x10a4: 0x1ee2, 0x10a5: 0x1e7e, 0x10a6: 0x1e83, 0x10a7: 0x1e88, 0x10a8: 0x1e92, 0x10a9: 0x1e8d, + 0x10aa: 0x1e65, 0x10ab: 0x1eb0, 0x10ac: 0x1ed3, 0x10ad: 0x1e7e, 0x10ae: 0x1e83, 0x10af: 0x1e88, + 0x10b0: 0x1e92, 0x10b1: 0x1e6f, 0x10b2: 0x1e97, 0x10b3: 0x1eec, 0x10b4: 0x1e56, 0x10b5: 0x1e5b, + 0x10b6: 0x1e60, 0x10b7: 0x1e7e, 0x10b8: 0x1e83, 0x10b9: 0x1e88, 0x10ba: 0x1eec, 0x10bb: 0x1efb, + 0x10bc: 0x4408, 0x10bd: 0x4408, + // Block 0x43, offset 0x10c0 + 0x10d0: 0x2311, 0x10d1: 0x2326, + 0x10d2: 0x2326, 0x10d3: 0x232d, 0x10d4: 0x2334, 0x10d5: 0x2349, 0x10d6: 0x2350, 0x10d7: 0x2357, + 0x10d8: 0x237a, 0x10d9: 0x237a, 0x10da: 0x239d, 0x10db: 0x2396, 0x10dc: 0x23b2, 0x10dd: 0x23a4, + 0x10de: 0x23ab, 0x10df: 0x23ce, 0x10e0: 0x23ce, 0x10e1: 0x23c7, 0x10e2: 0x23d5, 0x10e3: 0x23d5, + 0x10e4: 0x23ff, 0x10e5: 0x23ff, 0x10e6: 0x241b, 0x10e7: 0x23e3, 0x10e8: 0x23e3, 0x10e9: 0x23dc, + 0x10ea: 0x23f1, 0x10eb: 0x23f1, 0x10ec: 0x23f8, 0x10ed: 0x23f8, 0x10ee: 0x2422, 0x10ef: 0x2430, + 0x10f0: 0x2430, 0x10f1: 0x2437, 0x10f2: 0x2437, 0x10f3: 0x243e, 0x10f4: 0x2445, 0x10f5: 0x244c, + 0x10f6: 0x2453, 0x10f7: 0x2453, 0x10f8: 0x245a, 0x10f9: 0x2468, 0x10fa: 0x2476, 0x10fb: 0x246f, + 0x10fc: 0x247d, 0x10fd: 0x247d, 0x10fe: 0x2492, 0x10ff: 0x2499, + // Block 0x44, offset 0x1100 + 0x1100: 0x24ca, 0x1101: 0x24d8, 0x1102: 0x24d1, 0x1103: 0x24b5, 0x1104: 0x24b5, 0x1105: 0x24df, + 0x1106: 0x24df, 0x1107: 0x24e6, 0x1108: 0x24e6, 0x1109: 0x2510, 0x110a: 0x2517, 0x110b: 0x251e, + 0x110c: 0x24f4, 0x110d: 0x2502, 0x110e: 0x2525, 0x110f: 0x252c, + 0x1112: 0x24fb, 0x1113: 0x2580, 0x1114: 0x2587, 0x1115: 0x255d, 0x1116: 0x2564, 0x1117: 0x2548, + 0x1118: 0x2548, 0x1119: 0x254f, 0x111a: 0x2579, 0x111b: 0x2572, 0x111c: 0x259c, 0x111d: 0x259c, + 0x111e: 0x230a, 0x111f: 0x231f, 0x1120: 0x2318, 0x1121: 0x2342, 0x1122: 0x233b, 0x1123: 0x2365, + 0x1124: 0x235e, 0x1125: 0x2388, 0x1126: 0x236c, 0x1127: 0x2381, 0x1128: 0x23b9, 0x1129: 0x2406, + 0x112a: 0x23ea, 0x112b: 0x2429, 0x112c: 0x24c3, 0x112d: 0x24ed, 0x112e: 0x2595, 0x112f: 0x258e, + 0x1130: 0x25a3, 0x1131: 0x253a, 0x1132: 0x24a0, 0x1133: 0x256b, 0x1134: 0x2492, 0x1135: 0x24ca, + 0x1136: 0x2461, 0x1137: 0x24ae, 0x1138: 0x2541, 0x1139: 0x2533, 0x113a: 0x24bc, 0x113b: 0x24a7, + 0x113c: 0x24bc, 0x113d: 0x2541, 0x113e: 0x2373, 0x113f: 0x238f, + // Block 0x45, offset 0x1140 + 0x1140: 0x2509, 0x1141: 0x2484, 0x1142: 0x2303, 0x1143: 0x24a7, 0x1144: 0x244c, 0x1145: 0x241b, + 0x1146: 0x23c0, 0x1147: 0x2556, + 0x1170: 0x2414, 0x1171: 0x248b, 0x1172: 0x27bf, 0x1173: 0x27b6, 0x1174: 0x27ec, 0x1175: 0x27da, + 0x1176: 0x27c8, 0x1177: 0x27e3, 0x1178: 0x27f5, 0x1179: 0x240d, 0x117a: 0x2c7c, 0x117b: 0x2afc, + 0x117c: 0x27d1, + // Block 0x46, offset 0x1180 + 0x1190: 0x0019, 0x1191: 0x0483, + 0x1192: 0x0487, 0x1193: 0x0035, 0x1194: 0x0037, 0x1195: 0x0003, 0x1196: 0x003f, 0x1197: 0x04bf, + 0x1198: 0x04c3, 0x1199: 0x1b5c, + 0x11a0: 0x8132, 0x11a1: 0x8132, 0x11a2: 0x8132, 0x11a3: 0x8132, + 0x11a4: 0x8132, 0x11a5: 0x8132, 0x11a6: 0x8132, 0x11a7: 0x812d, 0x11a8: 0x812d, 0x11a9: 0x812d, + 0x11aa: 0x812d, 0x11ab: 0x812d, 0x11ac: 0x812d, 0x11ad: 0x812d, 0x11ae: 0x8132, 0x11af: 0x8132, + 0x11b0: 0x1873, 0x11b1: 0x0443, 0x11b2: 0x043f, 0x11b3: 0x007f, 0x11b4: 0x007f, 0x11b5: 0x0011, + 0x11b6: 0x0013, 0x11b7: 0x00b7, 0x11b8: 0x00bb, 0x11b9: 0x04b7, 0x11ba: 0x04bb, 0x11bb: 0x04ab, + 0x11bc: 0x04af, 0x11bd: 0x0493, 0x11be: 0x0497, 0x11bf: 0x048b, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x048f, 0x11c1: 0x049b, 0x11c2: 0x049f, 0x11c3: 0x04a3, 0x11c4: 0x04a7, + 0x11c7: 0x0077, 0x11c8: 0x007b, 0x11c9: 0x4269, 0x11ca: 0x4269, 0x11cb: 0x4269, + 0x11cc: 0x4269, 0x11cd: 0x007f, 0x11ce: 0x007f, 0x11cf: 0x007f, 0x11d0: 0x0019, 0x11d1: 0x0483, + 0x11d2: 0x001d, 0x11d4: 0x0037, 0x11d5: 0x0035, 0x11d6: 0x003f, 0x11d7: 0x0003, + 0x11d8: 0x0443, 0x11d9: 0x0011, 0x11da: 0x0013, 0x11db: 0x00b7, 0x11dc: 0x00bb, 0x11dd: 0x04b7, + 0x11de: 0x04bb, 0x11df: 0x0007, 0x11e0: 0x000d, 0x11e1: 0x0015, 0x11e2: 0x0017, 0x11e3: 0x001b, + 0x11e4: 0x0039, 0x11e5: 0x003d, 0x11e6: 0x003b, 0x11e8: 0x0079, 0x11e9: 0x0009, + 0x11ea: 0x000b, 0x11eb: 0x0041, + 0x11f0: 0x42aa, 0x11f1: 0x442c, 0x11f2: 0x42af, 0x11f4: 0x42b4, + 0x11f6: 0x42b9, 0x11f7: 0x4432, 0x11f8: 0x42be, 0x11f9: 0x4438, 0x11fa: 0x42c3, 0x11fb: 0x443e, + 0x11fc: 0x42c8, 0x11fd: 0x4444, 0x11fe: 0x42cd, 0x11ff: 0x444a, + // Block 0x48, offset 0x1200 + 0x1200: 0x0236, 0x1201: 0x440e, 0x1202: 0x440e, 0x1203: 0x4414, 0x1204: 0x4414, 0x1205: 0x4456, + 0x1206: 0x4456, 0x1207: 0x441a, 0x1208: 0x441a, 0x1209: 0x4462, 0x120a: 0x4462, 0x120b: 0x4462, + 0x120c: 0x4462, 0x120d: 0x0239, 0x120e: 0x0239, 0x120f: 0x023c, 0x1210: 0x023c, 0x1211: 0x023c, + 0x1212: 0x023c, 0x1213: 0x023f, 0x1214: 0x023f, 0x1215: 0x0242, 0x1216: 0x0242, 0x1217: 0x0242, + 0x1218: 0x0242, 0x1219: 0x0245, 0x121a: 0x0245, 0x121b: 0x0245, 0x121c: 0x0245, 0x121d: 0x0248, + 0x121e: 0x0248, 0x121f: 0x0248, 0x1220: 0x0248, 0x1221: 0x024b, 0x1222: 0x024b, 0x1223: 0x024b, + 0x1224: 0x024b, 0x1225: 0x024e, 0x1226: 0x024e, 0x1227: 0x024e, 0x1228: 0x024e, 0x1229: 0x0251, + 0x122a: 0x0251, 0x122b: 0x0254, 0x122c: 0x0254, 0x122d: 0x0257, 0x122e: 0x0257, 0x122f: 0x025a, + 0x1230: 0x025a, 0x1231: 0x025d, 0x1232: 0x025d, 0x1233: 0x025d, 0x1234: 0x025d, 0x1235: 0x0260, + 0x1236: 0x0260, 0x1237: 0x0260, 0x1238: 0x0260, 0x1239: 0x0263, 0x123a: 0x0263, 0x123b: 0x0263, + 0x123c: 0x0263, 0x123d: 0x0266, 0x123e: 0x0266, 0x123f: 0x0266, + // Block 0x49, offset 0x1240 + 0x1240: 0x0266, 0x1241: 0x0269, 0x1242: 0x0269, 0x1243: 0x0269, 0x1244: 0x0269, 0x1245: 0x026c, + 0x1246: 0x026c, 0x1247: 0x026c, 0x1248: 0x026c, 0x1249: 0x026f, 0x124a: 0x026f, 0x124b: 0x026f, + 0x124c: 0x026f, 0x124d: 0x0272, 0x124e: 0x0272, 0x124f: 0x0272, 0x1250: 0x0272, 0x1251: 0x0275, + 0x1252: 0x0275, 0x1253: 0x0275, 0x1254: 0x0275, 0x1255: 0x0278, 0x1256: 0x0278, 0x1257: 0x0278, + 0x1258: 0x0278, 0x1259: 0x027b, 0x125a: 0x027b, 0x125b: 0x027b, 0x125c: 0x027b, 0x125d: 0x027e, + 0x125e: 0x027e, 0x125f: 0x027e, 0x1260: 0x027e, 0x1261: 0x0281, 0x1262: 0x0281, 0x1263: 0x0281, + 0x1264: 0x0281, 0x1265: 0x0284, 0x1266: 0x0284, 0x1267: 0x0284, 0x1268: 0x0284, 0x1269: 0x0287, + 0x126a: 0x0287, 0x126b: 0x0287, 0x126c: 0x0287, 0x126d: 0x028a, 0x126e: 0x028a, 0x126f: 0x028d, + 0x1270: 0x028d, 0x1271: 0x0290, 0x1272: 0x0290, 0x1273: 0x0290, 0x1274: 0x0290, 0x1275: 0x2e00, + 0x1276: 0x2e00, 0x1277: 0x2e08, 0x1278: 0x2e08, 0x1279: 0x2e10, 0x127a: 0x2e10, 0x127b: 0x1f82, + 0x127c: 0x1f82, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0081, 0x1281: 0x0083, 0x1282: 0x0085, 0x1283: 0x0087, 0x1284: 0x0089, 0x1285: 0x008b, + 0x1286: 0x008d, 0x1287: 0x008f, 0x1288: 0x0091, 0x1289: 0x0093, 0x128a: 0x0095, 0x128b: 0x0097, + 0x128c: 0x0099, 0x128d: 0x009b, 0x128e: 0x009d, 0x128f: 0x009f, 0x1290: 0x00a1, 0x1291: 0x00a3, + 0x1292: 0x00a5, 0x1293: 0x00a7, 0x1294: 0x00a9, 0x1295: 0x00ab, 0x1296: 0x00ad, 0x1297: 0x00af, + 0x1298: 0x00b1, 0x1299: 0x00b3, 0x129a: 0x00b5, 0x129b: 0x00b7, 0x129c: 0x00b9, 0x129d: 0x00bb, + 0x129e: 0x00bd, 0x129f: 0x0477, 0x12a0: 0x047b, 0x12a1: 0x0487, 0x12a2: 0x049b, 0x12a3: 0x049f, + 0x12a4: 0x0483, 0x12a5: 0x05ab, 0x12a6: 0x05a3, 0x12a7: 0x04c7, 0x12a8: 0x04cf, 0x12a9: 0x04d7, + 0x12aa: 0x04df, 0x12ab: 0x04e7, 0x12ac: 0x056b, 0x12ad: 0x0573, 0x12ae: 0x057b, 0x12af: 0x051f, + 0x12b0: 0x05af, 0x12b1: 0x04cb, 0x12b2: 0x04d3, 0x12b3: 0x04db, 0x12b4: 0x04e3, 0x12b5: 0x04eb, + 0x12b6: 0x04ef, 0x12b7: 0x04f3, 0x12b8: 0x04f7, 0x12b9: 0x04fb, 0x12ba: 0x04ff, 0x12bb: 0x0503, + 0x12bc: 0x0507, 0x12bd: 0x050b, 0x12be: 0x050f, 0x12bf: 0x0513, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0517, 0x12c1: 0x051b, 0x12c2: 0x0523, 0x12c3: 0x0527, 0x12c4: 0x052b, 0x12c5: 0x052f, + 0x12c6: 0x0533, 0x12c7: 0x0537, 0x12c8: 0x053b, 0x12c9: 0x053f, 0x12ca: 0x0543, 0x12cb: 0x0547, + 0x12cc: 0x054b, 0x12cd: 0x054f, 0x12ce: 0x0553, 0x12cf: 0x0557, 0x12d0: 0x055b, 0x12d1: 0x055f, + 0x12d2: 0x0563, 0x12d3: 0x0567, 0x12d4: 0x056f, 0x12d5: 0x0577, 0x12d6: 0x057f, 0x12d7: 0x0583, + 0x12d8: 0x0587, 0x12d9: 0x058b, 0x12da: 0x058f, 0x12db: 0x0593, 0x12dc: 0x0597, 0x12dd: 0x05a7, + 0x12de: 0x4a78, 0x12df: 0x4a7e, 0x12e0: 0x03c3, 0x12e1: 0x0313, 0x12e2: 0x0317, 0x12e3: 0x4a3b, + 0x12e4: 0x031b, 0x12e5: 0x4a41, 0x12e6: 0x4a47, 0x12e7: 0x031f, 0x12e8: 0x0323, 0x12e9: 0x0327, + 0x12ea: 0x4a4d, 0x12eb: 0x4a53, 0x12ec: 0x4a59, 0x12ed: 0x4a5f, 0x12ee: 0x4a65, 0x12ef: 0x4a6b, + 0x12f0: 0x0367, 0x12f1: 0x032b, 0x12f2: 0x032f, 0x12f3: 0x0333, 0x12f4: 0x037b, 0x12f5: 0x0337, + 0x12f6: 0x033b, 0x12f7: 0x033f, 0x12f8: 0x0343, 0x12f9: 0x0347, 0x12fa: 0x034b, 0x12fb: 0x034f, + 0x12fc: 0x0353, 0x12fd: 0x0357, 0x12fe: 0x035b, + // Block 0x4c, offset 0x1300 + 0x1302: 0x49bd, 0x1303: 0x49c3, 0x1304: 0x49c9, 0x1305: 0x49cf, + 0x1306: 0x49d5, 0x1307: 0x49db, 0x130a: 0x49e1, 0x130b: 0x49e7, + 0x130c: 0x49ed, 0x130d: 0x49f3, 0x130e: 0x49f9, 0x130f: 0x49ff, + 0x1312: 0x4a05, 0x1313: 0x4a0b, 0x1314: 0x4a11, 0x1315: 0x4a17, 0x1316: 0x4a1d, 0x1317: 0x4a23, + 0x131a: 0x4a29, 0x131b: 0x4a2f, 0x131c: 0x4a35, + 0x1320: 0x00bf, 0x1321: 0x00c2, 0x1322: 0x00cb, 0x1323: 0x4264, + 0x1324: 0x00c8, 0x1325: 0x00c5, 0x1326: 0x0447, 0x1328: 0x046b, 0x1329: 0x044b, + 0x132a: 0x044f, 0x132b: 0x0453, 0x132c: 0x0457, 0x132d: 0x046f, 0x132e: 0x0473, + // Block 0x4d, offset 0x1340 + 0x1340: 0x0063, 0x1341: 0x0065, 0x1342: 0x0067, 0x1343: 0x0069, 0x1344: 0x006b, 0x1345: 0x006d, + 0x1346: 0x006f, 0x1347: 0x0071, 0x1348: 0x0073, 0x1349: 0x0075, 0x134a: 0x0083, 0x134b: 0x0085, + 0x134c: 0x0087, 0x134d: 0x0089, 0x134e: 0x008b, 0x134f: 0x008d, 0x1350: 0x008f, 0x1351: 0x0091, + 0x1352: 0x0093, 0x1353: 0x0095, 0x1354: 0x0097, 0x1355: 0x0099, 0x1356: 0x009b, 0x1357: 0x009d, + 0x1358: 0x009f, 0x1359: 0x00a1, 0x135a: 0x00a3, 0x135b: 0x00a5, 0x135c: 0x00a7, 0x135d: 0x00a9, + 0x135e: 0x00ab, 0x135f: 0x00ad, 0x1360: 0x00af, 0x1361: 0x00b1, 0x1362: 0x00b3, 0x1363: 0x00b5, + 0x1364: 0x00dd, 0x1365: 0x00f2, 0x1368: 0x0173, 0x1369: 0x0176, + 0x136a: 0x0179, 0x136b: 0x017c, 0x136c: 0x017f, 0x136d: 0x0182, 0x136e: 0x0185, 0x136f: 0x0188, + 0x1370: 0x018b, 0x1371: 0x018e, 0x1372: 0x0191, 0x1373: 0x0194, 0x1374: 0x0197, 0x1375: 0x019a, + 0x1376: 0x019d, 0x1377: 0x01a0, 0x1378: 0x01a3, 0x1379: 0x0188, 0x137a: 0x01a6, 0x137b: 0x01a9, + 0x137c: 0x01ac, 0x137d: 0x01af, 0x137e: 0x01b2, 0x137f: 0x01b5, + // Block 0x4e, offset 0x1380 + 0x1380: 0x01fd, 0x1381: 0x0200, 0x1382: 0x0203, 0x1383: 0x045b, 0x1384: 0x01c7, 0x1385: 0x01d0, + 0x1386: 0x01d6, 0x1387: 0x01fa, 0x1388: 0x01eb, 0x1389: 0x01e8, 0x138a: 0x0206, 0x138b: 0x0209, + 0x138e: 0x0021, 0x138f: 0x0023, 0x1390: 0x0025, 0x1391: 0x0027, + 0x1392: 0x0029, 0x1393: 0x002b, 0x1394: 0x002d, 0x1395: 0x002f, 0x1396: 0x0031, 0x1397: 0x0033, + 0x1398: 0x0021, 0x1399: 0x0023, 0x139a: 0x0025, 0x139b: 0x0027, 0x139c: 0x0029, 0x139d: 0x002b, + 0x139e: 0x002d, 0x139f: 0x002f, 0x13a0: 0x0031, 0x13a1: 0x0033, 0x13a2: 0x0021, 0x13a3: 0x0023, + 0x13a4: 0x0025, 0x13a5: 0x0027, 0x13a6: 0x0029, 0x13a7: 0x002b, 0x13a8: 0x002d, 0x13a9: 0x002f, + 0x13aa: 0x0031, 0x13ab: 0x0033, 0x13ac: 0x0021, 0x13ad: 0x0023, 0x13ae: 0x0025, 0x13af: 0x0027, + 0x13b0: 0x0029, 0x13b1: 0x002b, 0x13b2: 0x002d, 0x13b3: 0x002f, 0x13b4: 0x0031, 0x13b5: 0x0033, + 0x13b6: 0x0021, 0x13b7: 0x0023, 0x13b8: 0x0025, 0x13b9: 0x0027, 0x13ba: 0x0029, 0x13bb: 0x002b, + 0x13bc: 0x002d, 0x13bd: 0x002f, 0x13be: 0x0031, 0x13bf: 0x0033, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0239, 0x13c1: 0x023c, 0x13c2: 0x0248, 0x13c3: 0x0251, 0x13c5: 0x028a, + 0x13c6: 0x025a, 0x13c7: 0x024b, 0x13c8: 0x0269, 0x13c9: 0x0290, 0x13ca: 0x027b, 0x13cb: 0x027e, + 0x13cc: 0x0281, 0x13cd: 0x0284, 0x13ce: 0x025d, 0x13cf: 0x026f, 0x13d0: 0x0275, 0x13d1: 0x0263, + 0x13d2: 0x0278, 0x13d3: 0x0257, 0x13d4: 0x0260, 0x13d5: 0x0242, 0x13d6: 0x0245, 0x13d7: 0x024e, + 0x13d8: 0x0254, 0x13d9: 0x0266, 0x13da: 0x026c, 0x13db: 0x0272, 0x13dc: 0x0293, 0x13dd: 0x02e4, + 0x13de: 0x02cc, 0x13df: 0x0296, 0x13e1: 0x023c, 0x13e2: 0x0248, + 0x13e4: 0x0287, 0x13e7: 0x024b, 0x13e9: 0x0290, + 0x13ea: 0x027b, 0x13eb: 0x027e, 0x13ec: 0x0281, 0x13ed: 0x0284, 0x13ee: 0x025d, 0x13ef: 0x026f, + 0x13f0: 0x0275, 0x13f1: 0x0263, 0x13f2: 0x0278, 0x13f4: 0x0260, 0x13f5: 0x0242, + 0x13f6: 0x0245, 0x13f7: 0x024e, 0x13f9: 0x0266, 0x13fb: 0x0272, + // Block 0x50, offset 0x1400 + 0x1402: 0x0248, + 0x1407: 0x024b, 0x1409: 0x0290, 0x140b: 0x027e, + 0x140d: 0x0284, 0x140e: 0x025d, 0x140f: 0x026f, 0x1411: 0x0263, + 0x1412: 0x0278, 0x1414: 0x0260, 0x1417: 0x024e, + 0x1419: 0x0266, 0x141b: 0x0272, 0x141d: 0x02e4, + 0x141f: 0x0296, 0x1421: 0x023c, 0x1422: 0x0248, + 0x1424: 0x0287, 0x1427: 0x024b, 0x1428: 0x0269, 0x1429: 0x0290, + 0x142a: 0x027b, 0x142c: 0x0281, 0x142d: 0x0284, 0x142e: 0x025d, 0x142f: 0x026f, + 0x1430: 0x0275, 0x1431: 0x0263, 0x1432: 0x0278, 0x1434: 0x0260, 0x1435: 0x0242, + 0x1436: 0x0245, 0x1437: 0x024e, 0x1439: 0x0266, 0x143a: 0x026c, 0x143b: 0x0272, + 0x143c: 0x0293, 0x143e: 0x02cc, + // Block 0x51, offset 0x1440 + 0x1440: 0x0239, 0x1441: 0x023c, 0x1442: 0x0248, 0x1443: 0x0251, 0x1444: 0x0287, 0x1445: 0x028a, + 0x1446: 0x025a, 0x1447: 0x024b, 0x1448: 0x0269, 0x1449: 0x0290, 0x144b: 0x027e, + 0x144c: 0x0281, 0x144d: 0x0284, 0x144e: 0x025d, 0x144f: 0x026f, 0x1450: 0x0275, 0x1451: 0x0263, + 0x1452: 0x0278, 0x1453: 0x0257, 0x1454: 0x0260, 0x1455: 0x0242, 0x1456: 0x0245, 0x1457: 0x024e, + 0x1458: 0x0254, 0x1459: 0x0266, 0x145a: 0x026c, 0x145b: 0x0272, + 0x1461: 0x023c, 0x1462: 0x0248, 0x1463: 0x0251, + 0x1465: 0x028a, 0x1466: 0x025a, 0x1467: 0x024b, 0x1468: 0x0269, 0x1469: 0x0290, + 0x146b: 0x027e, 0x146c: 0x0281, 0x146d: 0x0284, 0x146e: 0x025d, 0x146f: 0x026f, + 0x1470: 0x0275, 0x1471: 0x0263, 0x1472: 0x0278, 0x1473: 0x0257, 0x1474: 0x0260, 0x1475: 0x0242, + 0x1476: 0x0245, 0x1477: 0x024e, 0x1478: 0x0254, 0x1479: 0x0266, 0x147a: 0x026c, 0x147b: 0x0272, + // Block 0x52, offset 0x1480 + 0x1480: 0x1879, 0x1481: 0x1876, 0x1482: 0x187c, 0x1483: 0x18a0, 0x1484: 0x18c4, 0x1485: 0x18e8, + 0x1486: 0x190c, 0x1487: 0x1915, 0x1488: 0x191b, 0x1489: 0x1921, 0x148a: 0x1927, + 0x1490: 0x1a8c, 0x1491: 0x1a90, + 0x1492: 0x1a94, 0x1493: 0x1a98, 0x1494: 0x1a9c, 0x1495: 0x1aa0, 0x1496: 0x1aa4, 0x1497: 0x1aa8, + 0x1498: 0x1aac, 0x1499: 0x1ab0, 0x149a: 0x1ab4, 0x149b: 0x1ab8, 0x149c: 0x1abc, 0x149d: 0x1ac0, + 0x149e: 0x1ac4, 0x149f: 0x1ac8, 0x14a0: 0x1acc, 0x14a1: 0x1ad0, 0x14a2: 0x1ad4, 0x14a3: 0x1ad8, + 0x14a4: 0x1adc, 0x14a5: 0x1ae0, 0x14a6: 0x1ae4, 0x14a7: 0x1ae8, 0x14a8: 0x1aec, 0x14a9: 0x1af0, + 0x14aa: 0x271e, 0x14ab: 0x0047, 0x14ac: 0x0065, 0x14ad: 0x193c, 0x14ae: 0x19b1, + 0x14b0: 0x0043, 0x14b1: 0x0045, 0x14b2: 0x0047, 0x14b3: 0x0049, 0x14b4: 0x004b, 0x14b5: 0x004d, + 0x14b6: 0x004f, 0x14b7: 0x0051, 0x14b8: 0x0053, 0x14b9: 0x0055, 0x14ba: 0x0057, 0x14bb: 0x0059, + 0x14bc: 0x005b, 0x14bd: 0x005d, 0x14be: 0x005f, 0x14bf: 0x0061, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x26ad, 0x14c1: 0x26c2, 0x14c2: 0x0503, + 0x14d0: 0x0c0f, 0x14d1: 0x0a47, + 0x14d2: 0x08d3, 0x14d3: 0x45c4, 0x14d4: 0x071b, 0x14d5: 0x09ef, 0x14d6: 0x132f, 0x14d7: 0x09ff, + 0x14d8: 0x0727, 0x14d9: 0x0cd7, 0x14da: 0x0eaf, 0x14db: 0x0caf, 0x14dc: 0x0827, 0x14dd: 0x0b6b, + 0x14de: 0x07bf, 0x14df: 0x0cb7, 0x14e0: 0x0813, 0x14e1: 0x1117, 0x14e2: 0x0f83, 0x14e3: 0x138b, + 0x14e4: 0x09d3, 0x14e5: 0x090b, 0x14e6: 0x0e63, 0x14e7: 0x0c1b, 0x14e8: 0x0c47, 0x14e9: 0x06bf, + 0x14ea: 0x06cb, 0x14eb: 0x140b, 0x14ec: 0x0adb, 0x14ed: 0x06e7, 0x14ee: 0x08ef, 0x14ef: 0x0c3b, + 0x14f0: 0x13b3, 0x14f1: 0x0c13, 0x14f2: 0x106f, 0x14f3: 0x10ab, 0x14f4: 0x08f7, 0x14f5: 0x0e43, + 0x14f6: 0x0d0b, 0x14f7: 0x0d07, 0x14f8: 0x0f97, 0x14f9: 0x082b, 0x14fa: 0x0957, 0x14fb: 0x1443, + // Block 0x54, offset 0x1500 + 0x1500: 0x06fb, 0x1501: 0x06f3, 0x1502: 0x0703, 0x1503: 0x1647, 0x1504: 0x0747, 0x1505: 0x0757, + 0x1506: 0x075b, 0x1507: 0x0763, 0x1508: 0x076b, 0x1509: 0x076f, 0x150a: 0x077b, 0x150b: 0x0773, + 0x150c: 0x05b3, 0x150d: 0x165b, 0x150e: 0x078f, 0x150f: 0x0793, 0x1510: 0x0797, 0x1511: 0x07b3, + 0x1512: 0x164c, 0x1513: 0x05b7, 0x1514: 0x079f, 0x1515: 0x07bf, 0x1516: 0x1656, 0x1517: 0x07cf, + 0x1518: 0x07d7, 0x1519: 0x0737, 0x151a: 0x07df, 0x151b: 0x07e3, 0x151c: 0x1831, 0x151d: 0x07ff, + 0x151e: 0x0807, 0x151f: 0x05bf, 0x1520: 0x081f, 0x1521: 0x0823, 0x1522: 0x082b, 0x1523: 0x082f, + 0x1524: 0x05c3, 0x1525: 0x0847, 0x1526: 0x084b, 0x1527: 0x0857, 0x1528: 0x0863, 0x1529: 0x0867, + 0x152a: 0x086b, 0x152b: 0x0873, 0x152c: 0x0893, 0x152d: 0x0897, 0x152e: 0x089f, 0x152f: 0x08af, + 0x1530: 0x08b7, 0x1531: 0x08bb, 0x1532: 0x08bb, 0x1533: 0x08bb, 0x1534: 0x166a, 0x1535: 0x0e93, + 0x1536: 0x08cf, 0x1537: 0x08d7, 0x1538: 0x166f, 0x1539: 0x08e3, 0x153a: 0x08eb, 0x153b: 0x08f3, + 0x153c: 0x091b, 0x153d: 0x0907, 0x153e: 0x0913, 0x153f: 0x0917, + // Block 0x55, offset 0x1540 + 0x1540: 0x091f, 0x1541: 0x0927, 0x1542: 0x092b, 0x1543: 0x0933, 0x1544: 0x093b, 0x1545: 0x093f, + 0x1546: 0x093f, 0x1547: 0x0947, 0x1548: 0x094f, 0x1549: 0x0953, 0x154a: 0x095f, 0x154b: 0x0983, + 0x154c: 0x0967, 0x154d: 0x0987, 0x154e: 0x096b, 0x154f: 0x0973, 0x1550: 0x080b, 0x1551: 0x09cf, + 0x1552: 0x0997, 0x1553: 0x099b, 0x1554: 0x099f, 0x1555: 0x0993, 0x1556: 0x09a7, 0x1557: 0x09a3, + 0x1558: 0x09bb, 0x1559: 0x1674, 0x155a: 0x09d7, 0x155b: 0x09db, 0x155c: 0x09e3, 0x155d: 0x09ef, + 0x155e: 0x09f7, 0x155f: 0x0a13, 0x1560: 0x1679, 0x1561: 0x167e, 0x1562: 0x0a1f, 0x1563: 0x0a23, + 0x1564: 0x0a27, 0x1565: 0x0a1b, 0x1566: 0x0a2f, 0x1567: 0x05c7, 0x1568: 0x05cb, 0x1569: 0x0a37, + 0x156a: 0x0a3f, 0x156b: 0x0a3f, 0x156c: 0x1683, 0x156d: 0x0a5b, 0x156e: 0x0a5f, 0x156f: 0x0a63, + 0x1570: 0x0a6b, 0x1571: 0x1688, 0x1572: 0x0a73, 0x1573: 0x0a77, 0x1574: 0x0b4f, 0x1575: 0x0a7f, + 0x1576: 0x05cf, 0x1577: 0x0a8b, 0x1578: 0x0a9b, 0x1579: 0x0aa7, 0x157a: 0x0aa3, 0x157b: 0x1692, + 0x157c: 0x0aaf, 0x157d: 0x1697, 0x157e: 0x0abb, 0x157f: 0x0ab7, + // Block 0x56, offset 0x1580 + 0x1580: 0x0abf, 0x1581: 0x0acf, 0x1582: 0x0ad3, 0x1583: 0x05d3, 0x1584: 0x0ae3, 0x1585: 0x0aeb, + 0x1586: 0x0aef, 0x1587: 0x0af3, 0x1588: 0x05d7, 0x1589: 0x169c, 0x158a: 0x05db, 0x158b: 0x0b0f, + 0x158c: 0x0b13, 0x158d: 0x0b17, 0x158e: 0x0b1f, 0x158f: 0x1863, 0x1590: 0x0b37, 0x1591: 0x16a6, + 0x1592: 0x16a6, 0x1593: 0x11d7, 0x1594: 0x0b47, 0x1595: 0x0b47, 0x1596: 0x05df, 0x1597: 0x16c9, + 0x1598: 0x179b, 0x1599: 0x0b57, 0x159a: 0x0b5f, 0x159b: 0x05e3, 0x159c: 0x0b73, 0x159d: 0x0b83, + 0x159e: 0x0b87, 0x159f: 0x0b8f, 0x15a0: 0x0b9f, 0x15a1: 0x05eb, 0x15a2: 0x05e7, 0x15a3: 0x0ba3, + 0x15a4: 0x16ab, 0x15a5: 0x0ba7, 0x15a6: 0x0bbb, 0x15a7: 0x0bbf, 0x15a8: 0x0bc3, 0x15a9: 0x0bbf, + 0x15aa: 0x0bcf, 0x15ab: 0x0bd3, 0x15ac: 0x0be3, 0x15ad: 0x0bdb, 0x15ae: 0x0bdf, 0x15af: 0x0be7, + 0x15b0: 0x0beb, 0x15b1: 0x0bef, 0x15b2: 0x0bfb, 0x15b3: 0x0bff, 0x15b4: 0x0c17, 0x15b5: 0x0c1f, + 0x15b6: 0x0c2f, 0x15b7: 0x0c43, 0x15b8: 0x16ba, 0x15b9: 0x0c3f, 0x15ba: 0x0c33, 0x15bb: 0x0c4b, + 0x15bc: 0x0c53, 0x15bd: 0x0c67, 0x15be: 0x16bf, 0x15bf: 0x0c6f, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x0c63, 0x15c1: 0x0c5b, 0x15c2: 0x05ef, 0x15c3: 0x0c77, 0x15c4: 0x0c7f, 0x15c5: 0x0c87, + 0x15c6: 0x0c7b, 0x15c7: 0x05f3, 0x15c8: 0x0c97, 0x15c9: 0x0c9f, 0x15ca: 0x16c4, 0x15cb: 0x0ccb, + 0x15cc: 0x0cff, 0x15cd: 0x0cdb, 0x15ce: 0x05ff, 0x15cf: 0x0ce7, 0x15d0: 0x05fb, 0x15d1: 0x05f7, + 0x15d2: 0x07c3, 0x15d3: 0x07c7, 0x15d4: 0x0d03, 0x15d5: 0x0ceb, 0x15d6: 0x11ab, 0x15d7: 0x0663, + 0x15d8: 0x0d0f, 0x15d9: 0x0d13, 0x15da: 0x0d17, 0x15db: 0x0d2b, 0x15dc: 0x0d23, 0x15dd: 0x16dd, + 0x15de: 0x0603, 0x15df: 0x0d3f, 0x15e0: 0x0d33, 0x15e1: 0x0d4f, 0x15e2: 0x0d57, 0x15e3: 0x16e7, + 0x15e4: 0x0d5b, 0x15e5: 0x0d47, 0x15e6: 0x0d63, 0x15e7: 0x0607, 0x15e8: 0x0d67, 0x15e9: 0x0d6b, + 0x15ea: 0x0d6f, 0x15eb: 0x0d7b, 0x15ec: 0x16ec, 0x15ed: 0x0d83, 0x15ee: 0x060b, 0x15ef: 0x0d8f, + 0x15f0: 0x16f1, 0x15f1: 0x0d93, 0x15f2: 0x060f, 0x15f3: 0x0d9f, 0x15f4: 0x0dab, 0x15f5: 0x0db7, + 0x15f6: 0x0dbb, 0x15f7: 0x16f6, 0x15f8: 0x168d, 0x15f9: 0x16fb, 0x15fa: 0x0ddb, 0x15fb: 0x1700, + 0x15fc: 0x0de7, 0x15fd: 0x0def, 0x15fe: 0x0ddf, 0x15ff: 0x0dfb, + // Block 0x58, offset 0x1600 + 0x1600: 0x0e0b, 0x1601: 0x0e1b, 0x1602: 0x0e0f, 0x1603: 0x0e13, 0x1604: 0x0e1f, 0x1605: 0x0e23, + 0x1606: 0x1705, 0x1607: 0x0e07, 0x1608: 0x0e3b, 0x1609: 0x0e3f, 0x160a: 0x0613, 0x160b: 0x0e53, + 0x160c: 0x0e4f, 0x160d: 0x170a, 0x160e: 0x0e33, 0x160f: 0x0e6f, 0x1610: 0x170f, 0x1611: 0x1714, + 0x1612: 0x0e73, 0x1613: 0x0e87, 0x1614: 0x0e83, 0x1615: 0x0e7f, 0x1616: 0x0617, 0x1617: 0x0e8b, + 0x1618: 0x0e9b, 0x1619: 0x0e97, 0x161a: 0x0ea3, 0x161b: 0x1651, 0x161c: 0x0eb3, 0x161d: 0x1719, + 0x161e: 0x0ebf, 0x161f: 0x1723, 0x1620: 0x0ed3, 0x1621: 0x0edf, 0x1622: 0x0ef3, 0x1623: 0x1728, + 0x1624: 0x0f07, 0x1625: 0x0f0b, 0x1626: 0x172d, 0x1627: 0x1732, 0x1628: 0x0f27, 0x1629: 0x0f37, + 0x162a: 0x061b, 0x162b: 0x0f3b, 0x162c: 0x061f, 0x162d: 0x061f, 0x162e: 0x0f53, 0x162f: 0x0f57, + 0x1630: 0x0f5f, 0x1631: 0x0f63, 0x1632: 0x0f6f, 0x1633: 0x0623, 0x1634: 0x0f87, 0x1635: 0x1737, + 0x1636: 0x0fa3, 0x1637: 0x173c, 0x1638: 0x0faf, 0x1639: 0x16a1, 0x163a: 0x0fbf, 0x163b: 0x1741, + 0x163c: 0x1746, 0x163d: 0x174b, 0x163e: 0x0627, 0x163f: 0x062b, + // Block 0x59, offset 0x1640 + 0x1640: 0x0ff7, 0x1641: 0x1755, 0x1642: 0x1750, 0x1643: 0x175a, 0x1644: 0x175f, 0x1645: 0x0fff, + 0x1646: 0x1003, 0x1647: 0x1003, 0x1648: 0x100b, 0x1649: 0x0633, 0x164a: 0x100f, 0x164b: 0x0637, + 0x164c: 0x063b, 0x164d: 0x1769, 0x164e: 0x1023, 0x164f: 0x102b, 0x1650: 0x1037, 0x1651: 0x063f, + 0x1652: 0x176e, 0x1653: 0x105b, 0x1654: 0x1773, 0x1655: 0x1778, 0x1656: 0x107b, 0x1657: 0x1093, + 0x1658: 0x0643, 0x1659: 0x109b, 0x165a: 0x109f, 0x165b: 0x10a3, 0x165c: 0x177d, 0x165d: 0x1782, + 0x165e: 0x1782, 0x165f: 0x10bb, 0x1660: 0x0647, 0x1661: 0x1787, 0x1662: 0x10cf, 0x1663: 0x10d3, + 0x1664: 0x064b, 0x1665: 0x178c, 0x1666: 0x10ef, 0x1667: 0x064f, 0x1668: 0x10ff, 0x1669: 0x10f7, + 0x166a: 0x1107, 0x166b: 0x1796, 0x166c: 0x111f, 0x166d: 0x0653, 0x166e: 0x112b, 0x166f: 0x1133, + 0x1670: 0x1143, 0x1671: 0x0657, 0x1672: 0x17a0, 0x1673: 0x17a5, 0x1674: 0x065b, 0x1675: 0x17aa, + 0x1676: 0x115b, 0x1677: 0x17af, 0x1678: 0x1167, 0x1679: 0x1173, 0x167a: 0x117b, 0x167b: 0x17b4, + 0x167c: 0x17b9, 0x167d: 0x118f, 0x167e: 0x17be, 0x167f: 0x1197, + // Block 0x5a, offset 0x1680 + 0x1680: 0x16ce, 0x1681: 0x065f, 0x1682: 0x11af, 0x1683: 0x11b3, 0x1684: 0x0667, 0x1685: 0x11b7, + 0x1686: 0x0a33, 0x1687: 0x17c3, 0x1688: 0x17c8, 0x1689: 0x16d3, 0x168a: 0x16d8, 0x168b: 0x11d7, + 0x168c: 0x11db, 0x168d: 0x13f3, 0x168e: 0x066b, 0x168f: 0x1207, 0x1690: 0x1203, 0x1691: 0x120b, + 0x1692: 0x083f, 0x1693: 0x120f, 0x1694: 0x1213, 0x1695: 0x1217, 0x1696: 0x121f, 0x1697: 0x17cd, + 0x1698: 0x121b, 0x1699: 0x1223, 0x169a: 0x1237, 0x169b: 0x123b, 0x169c: 0x1227, 0x169d: 0x123f, + 0x169e: 0x1253, 0x169f: 0x1267, 0x16a0: 0x1233, 0x16a1: 0x1247, 0x16a2: 0x124b, 0x16a3: 0x124f, + 0x16a4: 0x17d2, 0x16a5: 0x17dc, 0x16a6: 0x17d7, 0x16a7: 0x066f, 0x16a8: 0x126f, 0x16a9: 0x1273, + 0x16aa: 0x127b, 0x16ab: 0x17f0, 0x16ac: 0x127f, 0x16ad: 0x17e1, 0x16ae: 0x0673, 0x16af: 0x0677, + 0x16b0: 0x17e6, 0x16b1: 0x17eb, 0x16b2: 0x067b, 0x16b3: 0x129f, 0x16b4: 0x12a3, 0x16b5: 0x12a7, + 0x16b6: 0x12ab, 0x16b7: 0x12b7, 0x16b8: 0x12b3, 0x16b9: 0x12bf, 0x16ba: 0x12bb, 0x16bb: 0x12cb, + 0x16bc: 0x12c3, 0x16bd: 0x12c7, 0x16be: 0x12cf, 0x16bf: 0x067f, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x12d7, 0x16c1: 0x12db, 0x16c2: 0x0683, 0x16c3: 0x12eb, 0x16c4: 0x12ef, 0x16c5: 0x17f5, + 0x16c6: 0x12fb, 0x16c7: 0x12ff, 0x16c8: 0x0687, 0x16c9: 0x130b, 0x16ca: 0x05bb, 0x16cb: 0x17fa, + 0x16cc: 0x17ff, 0x16cd: 0x068b, 0x16ce: 0x068f, 0x16cf: 0x1337, 0x16d0: 0x134f, 0x16d1: 0x136b, + 0x16d2: 0x137b, 0x16d3: 0x1804, 0x16d4: 0x138f, 0x16d5: 0x1393, 0x16d6: 0x13ab, 0x16d7: 0x13b7, + 0x16d8: 0x180e, 0x16d9: 0x1660, 0x16da: 0x13c3, 0x16db: 0x13bf, 0x16dc: 0x13cb, 0x16dd: 0x1665, + 0x16de: 0x13d7, 0x16df: 0x13e3, 0x16e0: 0x1813, 0x16e1: 0x1818, 0x16e2: 0x1423, 0x16e3: 0x142f, + 0x16e4: 0x1437, 0x16e5: 0x181d, 0x16e6: 0x143b, 0x16e7: 0x1467, 0x16e8: 0x1473, 0x16e9: 0x1477, + 0x16ea: 0x146f, 0x16eb: 0x1483, 0x16ec: 0x1487, 0x16ed: 0x1822, 0x16ee: 0x1493, 0x16ef: 0x0693, + 0x16f0: 0x149b, 0x16f1: 0x1827, 0x16f2: 0x0697, 0x16f3: 0x14d3, 0x16f4: 0x0ac3, 0x16f5: 0x14eb, + 0x16f6: 0x182c, 0x16f7: 0x1836, 0x16f8: 0x069b, 0x16f9: 0x069f, 0x16fa: 0x1513, 0x16fb: 0x183b, + 0x16fc: 0x06a3, 0x16fd: 0x1840, 0x16fe: 0x152b, 0x16ff: 0x152b, + // Block 0x5c, offset 0x1700 + 0x1700: 0x1533, 0x1701: 0x1845, 0x1702: 0x154b, 0x1703: 0x06a7, 0x1704: 0x155b, 0x1705: 0x1567, + 0x1706: 0x156f, 0x1707: 0x1577, 0x1708: 0x06ab, 0x1709: 0x184a, 0x170a: 0x158b, 0x170b: 0x15a7, + 0x170c: 0x15b3, 0x170d: 0x06af, 0x170e: 0x06b3, 0x170f: 0x15b7, 0x1710: 0x184f, 0x1711: 0x06b7, + 0x1712: 0x1854, 0x1713: 0x1859, 0x1714: 0x185e, 0x1715: 0x15db, 0x1716: 0x06bb, 0x1717: 0x15ef, + 0x1718: 0x15f7, 0x1719: 0x15fb, 0x171a: 0x1603, 0x171b: 0x160b, 0x171c: 0x1613, 0x171d: 0x1868, +} + +// nfkcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5b, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x5c, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x5d, 0xcb: 0x5e, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x5f, 0xd2: 0x60, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x61, + 0xd8: 0x62, 0xd9: 0x0d, 0xdb: 0x63, 0xdc: 0x64, 0xdd: 0x65, 0xdf: 0x66, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x67, 0x121: 0x68, 0x123: 0x69, 0x124: 0x6a, 0x125: 0x6b, 0x126: 0x6c, 0x127: 0x6d, + 0x128: 0x6e, 0x129: 0x6f, 0x12a: 0x70, 0x12b: 0x71, 0x12c: 0x6c, 0x12d: 0x72, 0x12e: 0x73, 0x12f: 0x74, + 0x131: 0x75, 0x132: 0x76, 0x133: 0x77, 0x134: 0x78, 0x135: 0x79, 0x137: 0x7a, + 0x138: 0x7b, 0x139: 0x7c, 0x13a: 0x7d, 0x13b: 0x7e, 0x13c: 0x7f, 0x13d: 0x80, 0x13e: 0x81, 0x13f: 0x82, + // Block 0x5, offset 0x140 + 0x140: 0x83, 0x142: 0x84, 0x143: 0x85, 0x144: 0x86, 0x145: 0x87, 0x146: 0x88, 0x147: 0x89, + 0x14d: 0x8a, + 0x15c: 0x8b, 0x15f: 0x8c, + 0x162: 0x8d, 0x164: 0x8e, + 0x168: 0x8f, 0x169: 0x90, 0x16a: 0x91, 0x16c: 0x0e, 0x16d: 0x92, 0x16e: 0x93, 0x16f: 0x94, + 0x170: 0x95, 0x173: 0x96, 0x174: 0x97, 0x175: 0x0f, 0x176: 0x10, 0x177: 0x11, + 0x178: 0x12, 0x179: 0x13, 0x17a: 0x14, 0x17b: 0x15, 0x17c: 0x16, 0x17d: 0x17, 0x17e: 0x18, 0x17f: 0x19, + // Block 0x6, offset 0x180 + 0x180: 0x98, 0x181: 0x99, 0x182: 0x9a, 0x183: 0x9b, 0x184: 0x1a, 0x185: 0x1b, 0x186: 0x9c, 0x187: 0x9d, + 0x188: 0x9e, 0x189: 0x1c, 0x18a: 0x1d, 0x18b: 0x9f, 0x18c: 0xa0, + 0x191: 0x1e, 0x192: 0x1f, 0x193: 0xa1, + 0x1a8: 0xa2, 0x1a9: 0xa3, 0x1ab: 0xa4, + 0x1b1: 0xa5, 0x1b3: 0xa6, 0x1b5: 0xa7, 0x1b7: 0xa8, + 0x1ba: 0xa9, 0x1bb: 0xaa, 0x1bc: 0x20, 0x1bd: 0x21, 0x1be: 0x22, 0x1bf: 0xab, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xac, 0x1c1: 0x23, 0x1c2: 0x24, 0x1c3: 0x25, 0x1c4: 0xad, 0x1c5: 0x26, 0x1c6: 0x27, + 0x1c8: 0x28, 0x1c9: 0x29, 0x1ca: 0x2a, 0x1cb: 0x2b, 0x1cc: 0x2c, 0x1cd: 0x2d, 0x1ce: 0x2e, 0x1cf: 0x2f, + // Block 0x8, offset 0x200 + 0x219: 0xae, 0x21a: 0xaf, 0x21b: 0xb0, 0x21d: 0xb1, 0x21f: 0xb2, + 0x220: 0xb3, 0x223: 0xb4, 0x224: 0xb5, 0x225: 0xb6, 0x226: 0xb7, 0x227: 0xb8, + 0x22a: 0xb9, 0x22b: 0xba, 0x22d: 0xbb, 0x22f: 0xbc, + 0x230: 0xbd, 0x231: 0xbe, 0x232: 0xbf, 0x233: 0xc0, 0x234: 0xc1, 0x235: 0xc2, 0x236: 0xc3, 0x237: 0xbd, + 0x238: 0xbe, 0x239: 0xbf, 0x23a: 0xc0, 0x23b: 0xc1, 0x23c: 0xc2, 0x23d: 0xc3, 0x23e: 0xbd, 0x23f: 0xbe, + // Block 0x9, offset 0x240 + 0x240: 0xbf, 0x241: 0xc0, 0x242: 0xc1, 0x243: 0xc2, 0x244: 0xc3, 0x245: 0xbd, 0x246: 0xbe, 0x247: 0xbf, + 0x248: 0xc0, 0x249: 0xc1, 0x24a: 0xc2, 0x24b: 0xc3, 0x24c: 0xbd, 0x24d: 0xbe, 0x24e: 0xbf, 0x24f: 0xc0, + 0x250: 0xc1, 0x251: 0xc2, 0x252: 0xc3, 0x253: 0xbd, 0x254: 0xbe, 0x255: 0xbf, 0x256: 0xc0, 0x257: 0xc1, + 0x258: 0xc2, 0x259: 0xc3, 0x25a: 0xbd, 0x25b: 0xbe, 0x25c: 0xbf, 0x25d: 0xc0, 0x25e: 0xc1, 0x25f: 0xc2, + 0x260: 0xc3, 0x261: 0xbd, 0x262: 0xbe, 0x263: 0xbf, 0x264: 0xc0, 0x265: 0xc1, 0x266: 0xc2, 0x267: 0xc3, + 0x268: 0xbd, 0x269: 0xbe, 0x26a: 0xbf, 0x26b: 0xc0, 0x26c: 0xc1, 0x26d: 0xc2, 0x26e: 0xc3, 0x26f: 0xbd, + 0x270: 0xbe, 0x271: 0xbf, 0x272: 0xc0, 0x273: 0xc1, 0x274: 0xc2, 0x275: 0xc3, 0x276: 0xbd, 0x277: 0xbe, + 0x278: 0xbf, 0x279: 0xc0, 0x27a: 0xc1, 0x27b: 0xc2, 0x27c: 0xc3, 0x27d: 0xbd, 0x27e: 0xbe, 0x27f: 0xbf, + // Block 0xa, offset 0x280 + 0x280: 0xc0, 0x281: 0xc1, 0x282: 0xc2, 0x283: 0xc3, 0x284: 0xbd, 0x285: 0xbe, 0x286: 0xbf, 0x287: 0xc0, + 0x288: 0xc1, 0x289: 0xc2, 0x28a: 0xc3, 0x28b: 0xbd, 0x28c: 0xbe, 0x28d: 0xbf, 0x28e: 0xc0, 0x28f: 0xc1, + 0x290: 0xc2, 0x291: 0xc3, 0x292: 0xbd, 0x293: 0xbe, 0x294: 0xbf, 0x295: 0xc0, 0x296: 0xc1, 0x297: 0xc2, + 0x298: 0xc3, 0x299: 0xbd, 0x29a: 0xbe, 0x29b: 0xbf, 0x29c: 0xc0, 0x29d: 0xc1, 0x29e: 0xc2, 0x29f: 0xc3, + 0x2a0: 0xbd, 0x2a1: 0xbe, 0x2a2: 0xbf, 0x2a3: 0xc0, 0x2a4: 0xc1, 0x2a5: 0xc2, 0x2a6: 0xc3, 0x2a7: 0xbd, + 0x2a8: 0xbe, 0x2a9: 0xbf, 0x2aa: 0xc0, 0x2ab: 0xc1, 0x2ac: 0xc2, 0x2ad: 0xc3, 0x2ae: 0xbd, 0x2af: 0xbe, + 0x2b0: 0xbf, 0x2b1: 0xc0, 0x2b2: 0xc1, 0x2b3: 0xc2, 0x2b4: 0xc3, 0x2b5: 0xbd, 0x2b6: 0xbe, 0x2b7: 0xbf, + 0x2b8: 0xc0, 0x2b9: 0xc1, 0x2ba: 0xc2, 0x2bb: 0xc3, 0x2bc: 0xbd, 0x2bd: 0xbe, 0x2be: 0xbf, 0x2bf: 0xc0, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc1, 0x2c1: 0xc2, 0x2c2: 0xc3, 0x2c3: 0xbd, 0x2c4: 0xbe, 0x2c5: 0xbf, 0x2c6: 0xc0, 0x2c7: 0xc1, + 0x2c8: 0xc2, 0x2c9: 0xc3, 0x2ca: 0xbd, 0x2cb: 0xbe, 0x2cc: 0xbf, 0x2cd: 0xc0, 0x2ce: 0xc1, 0x2cf: 0xc2, + 0x2d0: 0xc3, 0x2d1: 0xbd, 0x2d2: 0xbe, 0x2d3: 0xbf, 0x2d4: 0xc0, 0x2d5: 0xc1, 0x2d6: 0xc2, 0x2d7: 0xc3, + 0x2d8: 0xbd, 0x2d9: 0xbe, 0x2da: 0xbf, 0x2db: 0xc0, 0x2dc: 0xc1, 0x2dd: 0xc2, 0x2de: 0xc4, + // Block 0xc, offset 0x300 + 0x324: 0x30, 0x325: 0x31, 0x326: 0x32, 0x327: 0x33, + 0x328: 0x34, 0x329: 0x35, 0x32a: 0x36, 0x32b: 0x37, 0x32c: 0x38, 0x32d: 0x39, 0x32e: 0x3a, 0x32f: 0x3b, + 0x330: 0x3c, 0x331: 0x3d, 0x332: 0x3e, 0x333: 0x3f, 0x334: 0x40, 0x335: 0x41, 0x336: 0x42, 0x337: 0x43, + 0x338: 0x44, 0x339: 0x45, 0x33a: 0x46, 0x33b: 0x47, 0x33c: 0xc5, 0x33d: 0x48, 0x33e: 0x49, 0x33f: 0x4a, + // Block 0xd, offset 0x340 + 0x347: 0xc6, + 0x34b: 0xc7, 0x34d: 0xc8, + 0x368: 0xc9, 0x36b: 0xca, + // Block 0xe, offset 0x380 + 0x381: 0xcb, 0x382: 0xcc, 0x384: 0xcd, 0x385: 0xb7, 0x387: 0xce, + 0x388: 0xcf, 0x38b: 0xd0, 0x38c: 0x6c, 0x38d: 0xd1, + 0x391: 0xd2, 0x392: 0xd3, 0x393: 0xd4, 0x396: 0xd5, 0x397: 0xd6, + 0x398: 0xd7, 0x39a: 0xd8, 0x39c: 0xd9, + 0x3a8: 0xda, 0x3a9: 0xdb, 0x3aa: 0xdc, + 0x3b0: 0xd7, 0x3b5: 0xdd, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xde, 0x3ec: 0xdf, + // Block 0x10, offset 0x400 + 0x432: 0xe0, + // Block 0x11, offset 0x440 + 0x445: 0xe1, 0x446: 0xe2, 0x447: 0xe3, + 0x449: 0xe4, + 0x450: 0xe5, 0x451: 0xe6, 0x452: 0xe7, 0x453: 0xe8, 0x454: 0xe9, 0x455: 0xea, 0x456: 0xeb, 0x457: 0xec, + 0x458: 0xed, 0x459: 0xee, 0x45a: 0x4b, 0x45b: 0xef, 0x45c: 0xf0, 0x45d: 0xf1, 0x45e: 0xf2, 0x45f: 0x4c, + // Block 0x12, offset 0x480 + 0x480: 0xf3, + 0x4a3: 0xf4, 0x4a5: 0xf5, + 0x4b8: 0x4d, 0x4b9: 0x4e, 0x4ba: 0x4f, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x50, 0x4c5: 0xf6, 0x4c6: 0xf7, + 0x4c8: 0x51, 0x4c9: 0xf8, + // Block 0x14, offset 0x500 + 0x520: 0x52, 0x521: 0x53, 0x522: 0x54, 0x523: 0x55, 0x524: 0x56, 0x525: 0x57, 0x526: 0x58, 0x527: 0x59, + 0x528: 0x5a, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 158 entries, 316 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1b, 0x25, 0x35, 0x37, 0x3c, 0x47, 0x56, 0x63, 0x6b, 0x6f, 0x74, 0x76, 0x87, 0x8f, 0x96, 0x99, 0xa0, 0xa4, 0xa8, 0xaa, 0xac, 0xb5, 0xb9, 0xc0, 0xc5, 0xc8, 0xd2, 0xd5, 0xdc, 0xe4, 0xe8, 0xea, 0xed, 0xf1, 0xf7, 0x108, 0x114, 0x116, 0x11c, 0x11e, 0x120, 0x122, 0x124, 0x126, 0x128, 0x12a, 0x12d, 0x130, 0x132, 0x135, 0x138, 0x13c, 0x141, 0x14a, 0x14c, 0x14f, 0x151, 0x15c, 0x167, 0x175, 0x183, 0x193, 0x1a1, 0x1a8, 0x1ae, 0x1bd, 0x1c1, 0x1c3, 0x1c7, 0x1c9, 0x1cc, 0x1ce, 0x1d1, 0x1d3, 0x1d6, 0x1d8, 0x1da, 0x1dc, 0x1e8, 0x1f2, 0x1fc, 0x1ff, 0x203, 0x205, 0x207, 0x209, 0x20b, 0x20e, 0x210, 0x212, 0x214, 0x216, 0x21c, 0x21f, 0x223, 0x225, 0x22c, 0x232, 0x238, 0x240, 0x246, 0x24c, 0x252, 0x256, 0x258, 0x25a, 0x25c, 0x25e, 0x264, 0x267, 0x26a, 0x272, 0x279, 0x27c, 0x27f, 0x281, 0x289, 0x28c, 0x293, 0x296, 0x29c, 0x29e, 0x2a0, 0x2a3, 0x2a5, 0x2a7, 0x2a9, 0x2ab, 0x2ae, 0x2b0, 0x2b2, 0x2b4, 0x2c1, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d8, 0x2e4, 0x2e9, 0x2f2, 0x2f8, 0x2fd, 0x301, 0x306, 0x30a, 0x31a, 0x328, 0x336, 0x344, 0x34a, 0x34c, 0x34f, 0x359, 0x35b} + +// nfkcSparseValues: 869 entries, 3476 bytes +var nfkcSparseValues = [869]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x4278, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x4264, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x425a, lo: 0xb4, hi: 0xb4}, + {value: 0x01dc, lo: 0xb5, hi: 0xb5}, + {value: 0x4291, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x221c, lo: 0xbc, hi: 0xbc}, + {value: 0x2210, lo: 0xbd, hi: 0xbd}, + {value: 0x22b2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0003, lo: 0x08}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0119, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0143, lo: 0xb4, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb7}, + {value: 0x00b3, lo: 0xb8, hi: 0xb8}, + // Block 0x3, offset 0x1b + {value: 0x000a, lo: 0x09}, + {value: 0x426e, lo: 0x98, hi: 0x98}, + {value: 0x4273, lo: 0x99, hi: 0x9a}, + {value: 0x4296, lo: 0x9b, hi: 0x9b}, + {value: 0x425f, lo: 0x9c, hi: 0x9c}, + {value: 0x4282, lo: 0x9d, hi: 0x9d}, + {value: 0x0113, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x0167, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x25 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x37a5, lo: 0x90, hi: 0x90}, + {value: 0x37b1, lo: 0x91, hi: 0x91}, + {value: 0x379f, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3817, lo: 0x97, hi: 0x97}, + {value: 0x37e1, lo: 0x9c, hi: 0x9c}, + {value: 0x37c9, lo: 0x9d, hi: 0x9d}, + {value: 0x37f3, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x381d, lo: 0xb6, hi: 0xb6}, + {value: 0x3823, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x35 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x37 + {value: 0x0001, lo: 0x04}, + {value: 0x8113, lo: 0x81, hi: 0x82}, + {value: 0x8132, lo: 0x84, hi: 0x84}, + {value: 0x812d, lo: 0x85, hi: 0x85}, + {value: 0x810d, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3c + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x97}, + {value: 0x8119, lo: 0x98, hi: 0x98}, + {value: 0x811a, lo: 0x99, hi: 0x99}, + {value: 0x811b, lo: 0x9a, hi: 0x9a}, + {value: 0x3841, lo: 0xa2, hi: 0xa2}, + {value: 0x3847, lo: 0xa3, hi: 0xa3}, + {value: 0x3853, lo: 0xa4, hi: 0xa4}, + {value: 0x384d, lo: 0xa5, hi: 0xa5}, + {value: 0x3859, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x47 + {value: 0x0000, lo: 0x0e}, + {value: 0x386b, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x385f, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x3865, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8132, lo: 0x96, hi: 0x9c}, + {value: 0x8132, lo: 0x9f, hi: 0xa2}, + {value: 0x812d, lo: 0xa3, hi: 0xa3}, + {value: 0x8132, lo: 0xa4, hi: 0xa4}, + {value: 0x8132, lo: 0xa7, hi: 0xa8}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xac}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x56 + {value: 0x0000, lo: 0x0c}, + {value: 0x811f, lo: 0x91, hi: 0x91}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x812d, lo: 0xb1, hi: 0xb1}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb5, hi: 0xb6}, + {value: 0x812d, lo: 0xb7, hi: 0xb9}, + {value: 0x8132, lo: 0xba, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbc}, + {value: 0x8132, lo: 0xbd, hi: 0xbd}, + {value: 0x812d, lo: 0xbe, hi: 0xbe}, + {value: 0x8132, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x63 + {value: 0x0005, lo: 0x07}, + {value: 0x8132, lo: 0x80, hi: 0x80}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x812d, lo: 0x82, hi: 0x83}, + {value: 0x812d, lo: 0x84, hi: 0x85}, + {value: 0x812d, lo: 0x86, hi: 0x87}, + {value: 0x812d, lo: 0x88, hi: 0x89}, + {value: 0x8132, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6b + {value: 0x0000, lo: 0x03}, + {value: 0x8132, lo: 0xab, hi: 0xb1}, + {value: 0x812d, lo: 0xb2, hi: 0xb2}, + {value: 0x8132, lo: 0xb3, hi: 0xb3}, + // Block 0xc, offset 0x6f + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0x96, hi: 0x99}, + {value: 0x8132, lo: 0x9b, hi: 0xa3}, + {value: 0x8132, lo: 0xa5, hi: 0xa7}, + {value: 0x8132, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x74 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x76 + {value: 0x0000, lo: 0x10}, + {value: 0x8132, lo: 0x94, hi: 0xa1}, + {value: 0x812d, lo: 0xa3, hi: 0xa3}, + {value: 0x8132, lo: 0xa4, hi: 0xa5}, + {value: 0x812d, lo: 0xa6, hi: 0xa6}, + {value: 0x8132, lo: 0xa7, hi: 0xa8}, + {value: 0x812d, lo: 0xa9, hi: 0xa9}, + {value: 0x8132, lo: 0xaa, hi: 0xac}, + {value: 0x812d, lo: 0xad, hi: 0xaf}, + {value: 0x8116, lo: 0xb0, hi: 0xb0}, + {value: 0x8117, lo: 0xb1, hi: 0xb1}, + {value: 0x8118, lo: 0xb2, hi: 0xb2}, + {value: 0x8132, lo: 0xb3, hi: 0xb5}, + {value: 0x812d, lo: 0xb6, hi: 0xb6}, + {value: 0x8132, lo: 0xb7, hi: 0xb8}, + {value: 0x812d, lo: 0xb9, hi: 0xba}, + {value: 0x8132, lo: 0xbb, hi: 0xbf}, + // Block 0xf, offset 0x87 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x3ed8, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x3ee0, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x3ee8, lo: 0xb4, hi: 0xb4}, + {value: 0x9902, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x8f + {value: 0x0008, lo: 0x06}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x91, hi: 0x91}, + {value: 0x812d, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x93, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x94}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x96 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x99 + {value: 0x0008, lo: 0x06}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, + // Block 0x13, offset 0xa0 + {value: 0x0000, lo: 0x03}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0xa4 + {value: 0x0008, lo: 0x03}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0xa8 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xaa + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xac + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2cb6, lo: 0x88, hi: 0x88}, + {value: 0x2cae, lo: 0x8b, hi: 0x8b}, + {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xb5 + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2cc6, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xb9 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cce, lo: 0x8a, hi: 0x8a}, + {value: 0x2cde, lo: 0x8b, hi: 0x8b}, + {value: 0x2cd6, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xc0 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x3ef0, lo: 0x88, hi: 0x88}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8120, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xc5 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xc8 + {value: 0x0000, lo: 0x09}, + {value: 0x2ce6, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2cee, lo: 0x87, hi: 0x87}, + {value: 0x2cf6, lo: 0x88, hi: 0x88}, + {value: 0x2f50, lo: 0x8a, hi: 0x8a}, + {value: 0x2dd8, lo: 0x8b, hi: 0x8b}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xd2 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xd5 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cfe, lo: 0x8a, hi: 0x8a}, + {value: 0x2d0e, lo: 0x8b, hi: 0x8b}, + {value: 0x2d06, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xdc + {value: 0x6bea, lo: 0x07}, + {value: 0x9904, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x3ef8, lo: 0x9a, hi: 0x9a}, + {value: 0x2f58, lo: 0x9c, hi: 0x9c}, + {value: 0x2de3, lo: 0x9d, hi: 0x9d}, + {value: 0x2d16, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x2621, lo: 0xb3, hi: 0xb3}, + {value: 0x8122, lo: 0xb8, hi: 0xb9}, + {value: 0x8104, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xe8 + {value: 0x0000, lo: 0x01}, + {value: 0x8123, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xea + {value: 0x0000, lo: 0x02}, + {value: 0x2636, lo: 0xb3, hi: 0xb3}, + {value: 0x8124, lo: 0xb8, hi: 0xb9}, + // Block 0x23, offset 0xed + {value: 0x0000, lo: 0x03}, + {value: 0x8125, lo: 0x88, hi: 0x8b}, + {value: 0x2628, lo: 0x9c, hi: 0x9c}, + {value: 0x262f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xf1 + {value: 0x0000, lo: 0x05}, + {value: 0x030b, lo: 0x8c, hi: 0x8c}, + {value: 0x812d, lo: 0x98, hi: 0x99}, + {value: 0x812d, lo: 0xb5, hi: 0xb5}, + {value: 0x812d, lo: 0xb7, hi: 0xb7}, + {value: 0x812b, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xf7 + {value: 0x0000, lo: 0x10}, + {value: 0x2644, lo: 0x83, hi: 0x83}, + {value: 0x264b, lo: 0x8d, hi: 0x8d}, + {value: 0x2652, lo: 0x92, hi: 0x92}, + {value: 0x2659, lo: 0x97, hi: 0x97}, + {value: 0x2660, lo: 0x9c, hi: 0x9c}, + {value: 0x263d, lo: 0xa9, hi: 0xa9}, + {value: 0x8126, lo: 0xb1, hi: 0xb1}, + {value: 0x8127, lo: 0xb2, hi: 0xb2}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, + {value: 0x8128, lo: 0xb4, hi: 0xb4}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, + {value: 0x45f4, lo: 0xb7, hi: 0xb7}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, + {value: 0x45ff, lo: 0xb9, hi: 0xb9}, + {value: 0x8127, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0x108 + {value: 0x0000, lo: 0x0b}, + {value: 0x8127, lo: 0x80, hi: 0x80}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, + {value: 0x8132, lo: 0x82, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0x86, hi: 0x87}, + {value: 0x266e, lo: 0x93, hi: 0x93}, + {value: 0x2675, lo: 0x9d, hi: 0x9d}, + {value: 0x267c, lo: 0xa2, hi: 0xa2}, + {value: 0x2683, lo: 0xa7, hi: 0xa7}, + {value: 0x268a, lo: 0xac, hi: 0xac}, + {value: 0x2667, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x114 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x116 + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2d1e, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x11c + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x11e + {value: 0x0000, lo: 0x01}, + {value: 0x030f, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x120 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x122 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x124 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x126 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x128 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x12a + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x94, hi: 0x94}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x12d + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x130 + {value: 0x0000, lo: 0x01}, + {value: 0x8131, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x132 + {value: 0x0004, lo: 0x02}, + {value: 0x812e, lo: 0xb9, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x135 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x97, hi: 0x97}, + {value: 0x812d, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x138 + {value: 0x0000, lo: 0x03}, + {value: 0x8104, lo: 0xa0, hi: 0xa0}, + {value: 0x8132, lo: 0xb5, hi: 0xbc}, + {value: 0x812d, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x13c + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + {value: 0x812d, lo: 0xb5, hi: 0xba}, + {value: 0x8132, lo: 0xbb, hi: 0xbc}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x37, offset 0x141 + {value: 0x0000, lo: 0x08}, + {value: 0x2d66, lo: 0x80, hi: 0x80}, + {value: 0x2d6e, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2d76, lo: 0x83, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xac}, + {value: 0x8132, lo: 0xad, hi: 0xb3}, + // Block 0x38, offset 0x14a + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xaa, hi: 0xab}, + // Block 0x39, offset 0x14c + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xa6, hi: 0xa6}, + {value: 0x8104, lo: 0xb2, hi: 0xb3}, + // Block 0x3a, offset 0x14f + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x3b, offset 0x151 + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812d, lo: 0x95, hi: 0x99}, + {value: 0x8132, lo: 0x9a, hi: 0x9b}, + {value: 0x812d, lo: 0x9c, hi: 0x9f}, + {value: 0x8132, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + {value: 0x8132, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb8, hi: 0xb9}, + // Block 0x3c, offset 0x15c + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00e6, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00ef, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3d, offset 0x167 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x043b, lo: 0x91, hi: 0x91}, + {value: 0x429b, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x1873, lo: 0xa5, hi: 0xa5}, + {value: 0x1b5c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x2691, lo: 0xb3, hi: 0xb3}, + {value: 0x27fe, lo: 0xb4, hi: 0xb4}, + {value: 0x2698, lo: 0xb6, hi: 0xb6}, + {value: 0x2808, lo: 0xb7, hi: 0xb7}, + {value: 0x186d, lo: 0xbc, hi: 0xbc}, + {value: 0x4269, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x175 + {value: 0x0002, lo: 0x0d}, + {value: 0x1933, lo: 0x87, hi: 0x87}, + {value: 0x1930, lo: 0x88, hi: 0x88}, + {value: 0x1870, lo: 0x89, hi: 0x89}, + {value: 0x298e, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x0467, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x3f, offset 0x183 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x0467, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x0104, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1999, lo: 0xa8, hi: 0xa8}, + // Block 0x40, offset 0x193 + {value: 0x0000, lo: 0x0d}, + {value: 0x8132, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8132, lo: 0x9b, hi: 0x9c}, + {value: 0x8132, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8132, lo: 0xa7, hi: 0xa7}, + {value: 0x812d, lo: 0xa8, hi: 0xa8}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xaf}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + // Block 0x41, offset 0x1a1 + {value: 0x0007, lo: 0x06}, + {value: 0x2180, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3bb9, lo: 0x9a, hi: 0x9b}, + {value: 0x3bc7, lo: 0xae, hi: 0xae}, + // Block 0x42, offset 0x1a8 + {value: 0x000e, lo: 0x05}, + {value: 0x3bce, lo: 0x8d, hi: 0x8e}, + {value: 0x3bd5, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x43, offset 0x1ae + {value: 0x0173, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3be3, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3bea, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3bf1, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3bf8, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3bff, lo: 0xa6, hi: 0xa6}, + {value: 0x269f, lo: 0xac, hi: 0xad}, + {value: 0x26a6, lo: 0xaf, hi: 0xaf}, + {value: 0x281c, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x44, offset 0x1bd + {value: 0x0007, lo: 0x03}, + {value: 0x3c68, lo: 0xa0, hi: 0xa1}, + {value: 0x3c92, lo: 0xa2, hi: 0xa3}, + {value: 0x3cbc, lo: 0xaa, hi: 0xad}, + // Block 0x45, offset 0x1c1 + {value: 0x0004, lo: 0x01}, + {value: 0x048b, lo: 0xa9, hi: 0xaa}, + // Block 0x46, offset 0x1c3 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x47, offset 0x1c7 + {value: 0x0000, lo: 0x01}, + {value: 0x299b, lo: 0x8c, hi: 0x8c}, + // Block 0x48, offset 0x1c9 + {value: 0x0263, lo: 0x02}, + {value: 0x1b8c, lo: 0xb4, hi: 0xb4}, + {value: 0x192d, lo: 0xb5, hi: 0xb6}, + // Block 0x49, offset 0x1cc + {value: 0x0000, lo: 0x01}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, + // Block 0x4a, offset 0x1ce + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4b, offset 0x1d1 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xaf, hi: 0xb1}, + // Block 0x4c, offset 0x1d3 + {value: 0x0000, lo: 0x02}, + {value: 0x047f, lo: 0xaf, hi: 0xaf}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x4d, offset 0x1d6 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa0, hi: 0xbf}, + // Block 0x4e, offset 0x1d8 + {value: 0x0000, lo: 0x01}, + {value: 0x0dc3, lo: 0x9f, hi: 0x9f}, + // Block 0x4f, offset 0x1da + {value: 0x0000, lo: 0x01}, + {value: 0x162f, lo: 0xb3, hi: 0xb3}, + // Block 0x50, offset 0x1dc + {value: 0x0004, lo: 0x0b}, + {value: 0x1597, lo: 0x80, hi: 0x82}, + {value: 0x15af, lo: 0x83, hi: 0x83}, + {value: 0x15c7, lo: 0x84, hi: 0x85}, + {value: 0x15d7, lo: 0x86, hi: 0x89}, + {value: 0x15eb, lo: 0x8a, hi: 0x8c}, + {value: 0x15ff, lo: 0x8d, hi: 0x8d}, + {value: 0x1607, lo: 0x8e, hi: 0x8e}, + {value: 0x160f, lo: 0x8f, hi: 0x90}, + {value: 0x161b, lo: 0x91, hi: 0x93}, + {value: 0x162b, lo: 0x94, hi: 0x94}, + {value: 0x1633, lo: 0x95, hi: 0x95}, + // Block 0x51, offset 0x1e8 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812c, lo: 0xaa, hi: 0xaa}, + {value: 0x8131, lo: 0xab, hi: 0xab}, + {value: 0x8133, lo: 0xac, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x812f, lo: 0xae, hi: 0xae}, + {value: 0x812f, lo: 0xaf, hi: 0xaf}, + {value: 0x04b3, lo: 0xb6, hi: 0xb6}, + {value: 0x0887, lo: 0xb8, hi: 0xba}, + // Block 0x52, offset 0x1f2 + {value: 0x0006, lo: 0x09}, + {value: 0x0313, lo: 0xb1, hi: 0xb1}, + {value: 0x0317, lo: 0xb2, hi: 0xb2}, + {value: 0x4a3b, lo: 0xb3, hi: 0xb3}, + {value: 0x031b, lo: 0xb4, hi: 0xb4}, + {value: 0x4a41, lo: 0xb5, hi: 0xb6}, + {value: 0x031f, lo: 0xb7, hi: 0xb7}, + {value: 0x0323, lo: 0xb8, hi: 0xb8}, + {value: 0x0327, lo: 0xb9, hi: 0xb9}, + {value: 0x4a4d, lo: 0xba, hi: 0xbf}, + // Block 0x53, offset 0x1fc + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xaf, hi: 0xaf}, + {value: 0x8132, lo: 0xb4, hi: 0xbd}, + // Block 0x54, offset 0x1ff + {value: 0x0000, lo: 0x03}, + {value: 0x020f, lo: 0x9c, hi: 0x9c}, + {value: 0x0212, lo: 0x9d, hi: 0x9d}, + {value: 0x8132, lo: 0x9e, hi: 0x9f}, + // Block 0x55, offset 0x203 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb1}, + // Block 0x56, offset 0x205 + {value: 0x0000, lo: 0x01}, + {value: 0x163b, lo: 0xb0, hi: 0xb0}, + // Block 0x57, offset 0x207 + {value: 0x000c, lo: 0x01}, + {value: 0x00d7, lo: 0xb8, hi: 0xb9}, + // Block 0x58, offset 0x209 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xa0, hi: 0xb1}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xab, hi: 0xad}, + // Block 0x5b, offset 0x210 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x93, hi: 0x93}, + // Block 0x5c, offset 0x212 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb3, hi: 0xb3}, + // Block 0x5d, offset 0x214 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + // Block 0x5e, offset 0x216 + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb7, hi: 0xb8}, + {value: 0x8132, lo: 0xbe, hi: 0xbf}, + // Block 0x5f, offset 0x21c + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + // Block 0x60, offset 0x21f + {value: 0x0008, lo: 0x03}, + {value: 0x1637, lo: 0x9c, hi: 0x9d}, + {value: 0x0125, lo: 0x9e, hi: 0x9e}, + {value: 0x1643, lo: 0x9f, hi: 0x9f}, + // Block 0x61, offset 0x223 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xad, hi: 0xad}, + // Block 0x62, offset 0x225 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x63, offset 0x22c + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x64, offset 0x232 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x65, offset 0x238 + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x66, offset 0x240 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x67, offset 0x246 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x68, offset 0x24c + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x69, offset 0x252 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6a, offset 0x256 + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6b, offset 0x258 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x6c, offset 0x25a + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xa0, hi: 0xa0}, + // Block 0x6d, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb6, hi: 0xba}, + // Block 0x6e, offset 0x25e + {value: 0x002c, lo: 0x05}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x8f, hi: 0x8f}, + {value: 0x8132, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x6f, offset 0x264 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xa5, hi: 0xa5}, + {value: 0x812d, lo: 0xa6, hi: 0xa6}, + // Block 0x70, offset 0x267 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x71, offset 0x26a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4238, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4242, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x424c, lo: 0xab, hi: 0xab}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x72, offset 0x272 + {value: 0x0000, lo: 0x06}, + {value: 0x8132, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2d7e, lo: 0xae, hi: 0xae}, + {value: 0x2d88, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8104, lo: 0xb3, hi: 0xb4}, + // Block 0x73, offset 0x279 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x74, offset 0x27c + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb5, hi: 0xb5}, + {value: 0x8102, lo: 0xb6, hi: 0xb6}, + // Block 0x75, offset 0x27f + {value: 0x0002, lo: 0x01}, + {value: 0x8102, lo: 0xa9, hi: 0xaa}, + // Block 0x76, offset 0x281 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2d92, lo: 0x8b, hi: 0x8b}, + {value: 0x2d9c, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8132, lo: 0xa6, hi: 0xac}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + // Block 0x77, offset 0x289 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x86, hi: 0x86}, + // Block 0x78, offset 0x28c + {value: 0x6b5a, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2db0, lo: 0xbb, hi: 0xbb}, + {value: 0x2da6, lo: 0xbc, hi: 0xbd}, + {value: 0x2dba, lo: 0xbe, hi: 0xbe}, + // Block 0x79, offset 0x293 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x83, hi: 0x83}, + // Block 0x7a, offset 0x296 + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2dc4, lo: 0xba, hi: 0xba}, + {value: 0x2dce, lo: 0xbb, hi: 0xbb}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0x80, hi: 0x80}, + // Block 0x7c, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x7d, offset 0x2a0 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x7e, offset 0x2a3 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xab, hi: 0xab}, + // Block 0x7f, offset 0x2a5 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x80, offset 0x2a7 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x87, hi: 0x87}, + // Block 0x81, offset 0x2a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x99, hi: 0x99}, + // Block 0x82, offset 0x2ab + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0x82, hi: 0x82}, + {value: 0x8104, lo: 0x84, hi: 0x85}, + // Block 0x83, offset 0x2ae + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x84, offset 0x2b0 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb6}, + // Block 0x85, offset 0x2b2 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x86, offset 0x2b4 + {value: 0x0000, lo: 0x0c}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, + {value: 0x812b, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8130, lo: 0xad, hi: 0xad}, + {value: 0x812b, lo: 0xae, hi: 0xb2}, + {value: 0x812d, lo: 0xbb, hi: 0xbf}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x09}, + {value: 0x812d, lo: 0x80, hi: 0x82}, + {value: 0x8132, lo: 0x85, hi: 0x89}, + {value: 0x812d, lo: 0x8a, hi: 0x8b}, + {value: 0x8132, lo: 0xaa, hi: 0xad}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, + // Block 0x88, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x467a, lo: 0x80, hi: 0x80}, + // Block 0x89, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x82, hi: 0x84}, + // Block 0x8a, offset 0x2cf + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x8b, offset 0x2d3 + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x8c, offset 0x2d8 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x8d, offset 0x2e4 + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x8e, offset 0x2e9 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x8f, offset 0x2f2 + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x90, offset 0x2f8 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x91, offset 0x2fd + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0x92, offset 0x301 + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0x93, offset 0x306 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0x94, offset 0x30a + {value: 0x0003, lo: 0x0f}, + {value: 0x01b8, lo: 0x80, hi: 0x80}, + {value: 0x045f, lo: 0x81, hi: 0x81}, + {value: 0x01bb, lo: 0x82, hi: 0x9a}, + {value: 0x045b, lo: 0x9b, hi: 0x9b}, + {value: 0x01c7, lo: 0x9c, hi: 0x9c}, + {value: 0x01d0, lo: 0x9d, hi: 0x9d}, + {value: 0x01d6, lo: 0x9e, hi: 0x9e}, + {value: 0x01fa, lo: 0x9f, hi: 0x9f}, + {value: 0x01eb, lo: 0xa0, hi: 0xa0}, + {value: 0x01e8, lo: 0xa1, hi: 0xa1}, + {value: 0x0173, lo: 0xa2, hi: 0xb2}, + {value: 0x0188, lo: 0xb3, hi: 0xb3}, + {value: 0x01a6, lo: 0xb4, hi: 0xba}, + {value: 0x045f, lo: 0xbb, hi: 0xbb}, + {value: 0x01bb, lo: 0xbc, hi: 0xbf}, + // Block 0x95, offset 0x31a + {value: 0x0003, lo: 0x0d}, + {value: 0x01c7, lo: 0x80, hi: 0x94}, + {value: 0x045b, lo: 0x95, hi: 0x95}, + {value: 0x01c7, lo: 0x96, hi: 0x96}, + {value: 0x01d0, lo: 0x97, hi: 0x97}, + {value: 0x01d6, lo: 0x98, hi: 0x98}, + {value: 0x01fa, lo: 0x99, hi: 0x99}, + {value: 0x01eb, lo: 0x9a, hi: 0x9a}, + {value: 0x01e8, lo: 0x9b, hi: 0x9b}, + {value: 0x0173, lo: 0x9c, hi: 0xac}, + {value: 0x0188, lo: 0xad, hi: 0xad}, + {value: 0x01a6, lo: 0xae, hi: 0xb4}, + {value: 0x045f, lo: 0xb5, hi: 0xb5}, + {value: 0x01bb, lo: 0xb6, hi: 0xbf}, + // Block 0x96, offset 0x328 + {value: 0x0003, lo: 0x0d}, + {value: 0x01d9, lo: 0x80, hi: 0x8e}, + {value: 0x045b, lo: 0x8f, hi: 0x8f}, + {value: 0x01c7, lo: 0x90, hi: 0x90}, + {value: 0x01d0, lo: 0x91, hi: 0x91}, + {value: 0x01d6, lo: 0x92, hi: 0x92}, + {value: 0x01fa, lo: 0x93, hi: 0x93}, + {value: 0x01eb, lo: 0x94, hi: 0x94}, + {value: 0x01e8, lo: 0x95, hi: 0x95}, + {value: 0x0173, lo: 0x96, hi: 0xa6}, + {value: 0x0188, lo: 0xa7, hi: 0xa7}, + {value: 0x01a6, lo: 0xa8, hi: 0xae}, + {value: 0x045f, lo: 0xaf, hi: 0xaf}, + {value: 0x01bb, lo: 0xb0, hi: 0xbf}, + // Block 0x97, offset 0x336 + {value: 0x0003, lo: 0x0d}, + {value: 0x01eb, lo: 0x80, hi: 0x88}, + {value: 0x045b, lo: 0x89, hi: 0x89}, + {value: 0x01c7, lo: 0x8a, hi: 0x8a}, + {value: 0x01d0, lo: 0x8b, hi: 0x8b}, + {value: 0x01d6, lo: 0x8c, hi: 0x8c}, + {value: 0x01fa, lo: 0x8d, hi: 0x8d}, + {value: 0x01eb, lo: 0x8e, hi: 0x8e}, + {value: 0x01e8, lo: 0x8f, hi: 0x8f}, + {value: 0x0173, lo: 0x90, hi: 0xa0}, + {value: 0x0188, lo: 0xa1, hi: 0xa1}, + {value: 0x01a6, lo: 0xa2, hi: 0xa8}, + {value: 0x045f, lo: 0xa9, hi: 0xa9}, + {value: 0x01bb, lo: 0xaa, hi: 0xbf}, + // Block 0x98, offset 0x344 + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0x80, hi: 0x86}, + {value: 0x8132, lo: 0x88, hi: 0x98}, + {value: 0x8132, lo: 0x9b, hi: 0xa1}, + {value: 0x8132, lo: 0xa3, hi: 0xa4}, + {value: 0x8132, lo: 0xa6, hi: 0xaa}, + // Block 0x99, offset 0x34a + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x90, hi: 0x96}, + // Block 0x9a, offset 0x34c + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x84, hi: 0x89}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x9b, offset 0x34f + {value: 0x0002, lo: 0x09}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1951, lo: 0x8a, hi: 0x8a}, + {value: 0x1981, lo: 0x8b, hi: 0x8b}, + {value: 0x199c, lo: 0x8c, hi: 0x8c}, + {value: 0x19a2, lo: 0x8d, hi: 0x8d}, + {value: 0x1bc0, lo: 0x8e, hi: 0x8e}, + {value: 0x19ae, lo: 0x8f, hi: 0x8f}, + {value: 0x197b, lo: 0xaa, hi: 0xaa}, + {value: 0x197e, lo: 0xab, hi: 0xab}, + // Block 0x9c, offset 0x359 + {value: 0x0000, lo: 0x01}, + {value: 0x193f, lo: 0x90, hi: 0x90}, + // Block 0x9d, offset 0x35b + {value: 0x0028, lo: 0x09}, + {value: 0x2862, lo: 0x80, hi: 0x80}, + {value: 0x2826, lo: 0x81, hi: 0x81}, + {value: 0x2830, lo: 0x82, hi: 0x82}, + {value: 0x2844, lo: 0x83, hi: 0x84}, + {value: 0x284e, lo: 0x85, hi: 0x86}, + {value: 0x283a, lo: 0x87, hi: 0x87}, + {value: 0x2858, lo: 0x88, hi: 0x88}, + {value: 0x0b6f, lo: 0x90, hi: 0x90}, + {value: 0x08e7, lo: 0x91, hi: 0x91}, +} + +// recompMap: 7520 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "" + // Total size of tables: 53KB (54226 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/tables.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go similarity index 85% rename from vendor/golang.org/x/text/unicode/norm/tables.go rename to vendor/golang.org/x/text/unicode/norm/tables9.0.0.go index bf9ff8038c..9429069291 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables.go +++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go @@ -1,7 +1,11 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. +// +build !go1.10 + package norm +import "sync" + const ( // Version is the Unicode edition from which the tables are derived. Version = "9.0.0" @@ -6685,947 +6689,949 @@ var nfkcSparseValues = [875]valueRange{ } // recompMap: 7520 bytes (entries only) -var recompMap = map[uint32]rune{ - 0x00410300: 0x00C0, - 0x00410301: 0x00C1, - 0x00410302: 0x00C2, - 0x00410303: 0x00C3, - 0x00410308: 0x00C4, - 0x0041030A: 0x00C5, - 0x00430327: 0x00C7, - 0x00450300: 0x00C8, - 0x00450301: 0x00C9, - 0x00450302: 0x00CA, - 0x00450308: 0x00CB, - 0x00490300: 0x00CC, - 0x00490301: 0x00CD, - 0x00490302: 0x00CE, - 0x00490308: 0x00CF, - 0x004E0303: 0x00D1, - 0x004F0300: 0x00D2, - 0x004F0301: 0x00D3, - 0x004F0302: 0x00D4, - 0x004F0303: 0x00D5, - 0x004F0308: 0x00D6, - 0x00550300: 0x00D9, - 0x00550301: 0x00DA, - 0x00550302: 0x00DB, - 0x00550308: 0x00DC, - 0x00590301: 0x00DD, - 0x00610300: 0x00E0, - 0x00610301: 0x00E1, - 0x00610302: 0x00E2, - 0x00610303: 0x00E3, - 0x00610308: 0x00E4, - 0x0061030A: 0x00E5, - 0x00630327: 0x00E7, - 0x00650300: 0x00E8, - 0x00650301: 0x00E9, - 0x00650302: 0x00EA, - 0x00650308: 0x00EB, - 0x00690300: 0x00EC, - 0x00690301: 0x00ED, - 0x00690302: 0x00EE, - 0x00690308: 0x00EF, - 0x006E0303: 0x00F1, - 0x006F0300: 0x00F2, - 0x006F0301: 0x00F3, - 0x006F0302: 0x00F4, - 0x006F0303: 0x00F5, - 0x006F0308: 0x00F6, - 0x00750300: 0x00F9, - 0x00750301: 0x00FA, - 0x00750302: 0x00FB, - 0x00750308: 0x00FC, - 0x00790301: 0x00FD, - 0x00790308: 0x00FF, - 0x00410304: 0x0100, - 0x00610304: 0x0101, - 0x00410306: 0x0102, - 0x00610306: 0x0103, - 0x00410328: 0x0104, - 0x00610328: 0x0105, - 0x00430301: 0x0106, - 0x00630301: 0x0107, - 0x00430302: 0x0108, - 0x00630302: 0x0109, - 0x00430307: 0x010A, - 0x00630307: 0x010B, - 0x0043030C: 0x010C, - 0x0063030C: 0x010D, - 0x0044030C: 0x010E, - 0x0064030C: 0x010F, - 0x00450304: 0x0112, - 0x00650304: 0x0113, - 0x00450306: 0x0114, - 0x00650306: 0x0115, - 0x00450307: 0x0116, - 0x00650307: 0x0117, - 0x00450328: 0x0118, - 0x00650328: 0x0119, - 0x0045030C: 0x011A, - 0x0065030C: 0x011B, - 0x00470302: 0x011C, - 0x00670302: 0x011D, - 0x00470306: 0x011E, - 0x00670306: 0x011F, - 0x00470307: 0x0120, - 0x00670307: 0x0121, - 0x00470327: 0x0122, - 0x00670327: 0x0123, - 0x00480302: 0x0124, - 0x00680302: 0x0125, - 0x00490303: 0x0128, - 0x00690303: 0x0129, - 0x00490304: 0x012A, - 0x00690304: 0x012B, - 0x00490306: 0x012C, - 0x00690306: 0x012D, - 0x00490328: 0x012E, - 0x00690328: 0x012F, - 0x00490307: 0x0130, - 0x004A0302: 0x0134, - 0x006A0302: 0x0135, - 0x004B0327: 0x0136, - 0x006B0327: 0x0137, - 0x004C0301: 0x0139, - 0x006C0301: 0x013A, - 0x004C0327: 0x013B, - 0x006C0327: 0x013C, - 0x004C030C: 0x013D, - 0x006C030C: 0x013E, - 0x004E0301: 0x0143, - 0x006E0301: 0x0144, - 0x004E0327: 0x0145, - 0x006E0327: 0x0146, - 0x004E030C: 0x0147, - 0x006E030C: 0x0148, - 0x004F0304: 0x014C, - 0x006F0304: 0x014D, - 0x004F0306: 0x014E, - 0x006F0306: 0x014F, - 0x004F030B: 0x0150, - 0x006F030B: 0x0151, - 0x00520301: 0x0154, - 0x00720301: 0x0155, - 0x00520327: 0x0156, - 0x00720327: 0x0157, - 0x0052030C: 0x0158, - 0x0072030C: 0x0159, - 0x00530301: 0x015A, - 0x00730301: 0x015B, - 0x00530302: 0x015C, - 0x00730302: 0x015D, - 0x00530327: 0x015E, - 0x00730327: 0x015F, - 0x0053030C: 0x0160, - 0x0073030C: 0x0161, - 0x00540327: 0x0162, - 0x00740327: 0x0163, - 0x0054030C: 0x0164, - 0x0074030C: 0x0165, - 0x00550303: 0x0168, - 0x00750303: 0x0169, - 0x00550304: 0x016A, - 0x00750304: 0x016B, - 0x00550306: 0x016C, - 0x00750306: 0x016D, - 0x0055030A: 0x016E, - 0x0075030A: 0x016F, - 0x0055030B: 0x0170, - 0x0075030B: 0x0171, - 0x00550328: 0x0172, - 0x00750328: 0x0173, - 0x00570302: 0x0174, - 0x00770302: 0x0175, - 0x00590302: 0x0176, - 0x00790302: 0x0177, - 0x00590308: 0x0178, - 0x005A0301: 0x0179, - 0x007A0301: 0x017A, - 0x005A0307: 0x017B, - 0x007A0307: 0x017C, - 0x005A030C: 0x017D, - 0x007A030C: 0x017E, - 0x004F031B: 0x01A0, - 0x006F031B: 0x01A1, - 0x0055031B: 0x01AF, - 0x0075031B: 0x01B0, - 0x0041030C: 0x01CD, - 0x0061030C: 0x01CE, - 0x0049030C: 0x01CF, - 0x0069030C: 0x01D0, - 0x004F030C: 0x01D1, - 0x006F030C: 0x01D2, - 0x0055030C: 0x01D3, - 0x0075030C: 0x01D4, - 0x00DC0304: 0x01D5, - 0x00FC0304: 0x01D6, - 0x00DC0301: 0x01D7, - 0x00FC0301: 0x01D8, - 0x00DC030C: 0x01D9, - 0x00FC030C: 0x01DA, - 0x00DC0300: 0x01DB, - 0x00FC0300: 0x01DC, - 0x00C40304: 0x01DE, - 0x00E40304: 0x01DF, - 0x02260304: 0x01E0, - 0x02270304: 0x01E1, - 0x00C60304: 0x01E2, - 0x00E60304: 0x01E3, - 0x0047030C: 0x01E6, - 0x0067030C: 0x01E7, - 0x004B030C: 0x01E8, - 0x006B030C: 0x01E9, - 0x004F0328: 0x01EA, - 0x006F0328: 0x01EB, - 0x01EA0304: 0x01EC, - 0x01EB0304: 0x01ED, - 0x01B7030C: 0x01EE, - 0x0292030C: 0x01EF, - 0x006A030C: 0x01F0, - 0x00470301: 0x01F4, - 0x00670301: 0x01F5, - 0x004E0300: 0x01F8, - 0x006E0300: 0x01F9, - 0x00C50301: 0x01FA, - 0x00E50301: 0x01FB, - 0x00C60301: 0x01FC, - 0x00E60301: 0x01FD, - 0x00D80301: 0x01FE, - 0x00F80301: 0x01FF, - 0x0041030F: 0x0200, - 0x0061030F: 0x0201, - 0x00410311: 0x0202, - 0x00610311: 0x0203, - 0x0045030F: 0x0204, - 0x0065030F: 0x0205, - 0x00450311: 0x0206, - 0x00650311: 0x0207, - 0x0049030F: 0x0208, - 0x0069030F: 0x0209, - 0x00490311: 0x020A, - 0x00690311: 0x020B, - 0x004F030F: 0x020C, - 0x006F030F: 0x020D, - 0x004F0311: 0x020E, - 0x006F0311: 0x020F, - 0x0052030F: 0x0210, - 0x0072030F: 0x0211, - 0x00520311: 0x0212, - 0x00720311: 0x0213, - 0x0055030F: 0x0214, - 0x0075030F: 0x0215, - 0x00550311: 0x0216, - 0x00750311: 0x0217, - 0x00530326: 0x0218, - 0x00730326: 0x0219, - 0x00540326: 0x021A, - 0x00740326: 0x021B, - 0x0048030C: 0x021E, - 0x0068030C: 0x021F, - 0x00410307: 0x0226, - 0x00610307: 0x0227, - 0x00450327: 0x0228, - 0x00650327: 0x0229, - 0x00D60304: 0x022A, - 0x00F60304: 0x022B, - 0x00D50304: 0x022C, - 0x00F50304: 0x022D, - 0x004F0307: 0x022E, - 0x006F0307: 0x022F, - 0x022E0304: 0x0230, - 0x022F0304: 0x0231, - 0x00590304: 0x0232, - 0x00790304: 0x0233, - 0x00A80301: 0x0385, - 0x03910301: 0x0386, - 0x03950301: 0x0388, - 0x03970301: 0x0389, - 0x03990301: 0x038A, - 0x039F0301: 0x038C, - 0x03A50301: 0x038E, - 0x03A90301: 0x038F, - 0x03CA0301: 0x0390, - 0x03990308: 0x03AA, - 0x03A50308: 0x03AB, - 0x03B10301: 0x03AC, - 0x03B50301: 0x03AD, - 0x03B70301: 0x03AE, - 0x03B90301: 0x03AF, - 0x03CB0301: 0x03B0, - 0x03B90308: 0x03CA, - 0x03C50308: 0x03CB, - 0x03BF0301: 0x03CC, - 0x03C50301: 0x03CD, - 0x03C90301: 0x03CE, - 0x03D20301: 0x03D3, - 0x03D20308: 0x03D4, - 0x04150300: 0x0400, - 0x04150308: 0x0401, - 0x04130301: 0x0403, - 0x04060308: 0x0407, - 0x041A0301: 0x040C, - 0x04180300: 0x040D, - 0x04230306: 0x040E, - 0x04180306: 0x0419, - 0x04380306: 0x0439, - 0x04350300: 0x0450, - 0x04350308: 0x0451, - 0x04330301: 0x0453, - 0x04560308: 0x0457, - 0x043A0301: 0x045C, - 0x04380300: 0x045D, - 0x04430306: 0x045E, - 0x0474030F: 0x0476, - 0x0475030F: 0x0477, - 0x04160306: 0x04C1, - 0x04360306: 0x04C2, - 0x04100306: 0x04D0, - 0x04300306: 0x04D1, - 0x04100308: 0x04D2, - 0x04300308: 0x04D3, - 0x04150306: 0x04D6, - 0x04350306: 0x04D7, - 0x04D80308: 0x04DA, - 0x04D90308: 0x04DB, - 0x04160308: 0x04DC, - 0x04360308: 0x04DD, - 0x04170308: 0x04DE, - 0x04370308: 0x04DF, - 0x04180304: 0x04E2, - 0x04380304: 0x04E3, - 0x04180308: 0x04E4, - 0x04380308: 0x04E5, - 0x041E0308: 0x04E6, - 0x043E0308: 0x04E7, - 0x04E80308: 0x04EA, - 0x04E90308: 0x04EB, - 0x042D0308: 0x04EC, - 0x044D0308: 0x04ED, - 0x04230304: 0x04EE, - 0x04430304: 0x04EF, - 0x04230308: 0x04F0, - 0x04430308: 0x04F1, - 0x0423030B: 0x04F2, - 0x0443030B: 0x04F3, - 0x04270308: 0x04F4, - 0x04470308: 0x04F5, - 0x042B0308: 0x04F8, - 0x044B0308: 0x04F9, - 0x06270653: 0x0622, - 0x06270654: 0x0623, - 0x06480654: 0x0624, - 0x06270655: 0x0625, - 0x064A0654: 0x0626, - 0x06D50654: 0x06C0, - 0x06C10654: 0x06C2, - 0x06D20654: 0x06D3, - 0x0928093C: 0x0929, - 0x0930093C: 0x0931, - 0x0933093C: 0x0934, - 0x09C709BE: 0x09CB, - 0x09C709D7: 0x09CC, - 0x0B470B56: 0x0B48, - 0x0B470B3E: 0x0B4B, - 0x0B470B57: 0x0B4C, - 0x0B920BD7: 0x0B94, - 0x0BC60BBE: 0x0BCA, - 0x0BC70BBE: 0x0BCB, - 0x0BC60BD7: 0x0BCC, - 0x0C460C56: 0x0C48, - 0x0CBF0CD5: 0x0CC0, - 0x0CC60CD5: 0x0CC7, - 0x0CC60CD6: 0x0CC8, - 0x0CC60CC2: 0x0CCA, - 0x0CCA0CD5: 0x0CCB, - 0x0D460D3E: 0x0D4A, - 0x0D470D3E: 0x0D4B, - 0x0D460D57: 0x0D4C, - 0x0DD90DCA: 0x0DDA, - 0x0DD90DCF: 0x0DDC, - 0x0DDC0DCA: 0x0DDD, - 0x0DD90DDF: 0x0DDE, - 0x1025102E: 0x1026, - 0x1B051B35: 0x1B06, - 0x1B071B35: 0x1B08, - 0x1B091B35: 0x1B0A, - 0x1B0B1B35: 0x1B0C, - 0x1B0D1B35: 0x1B0E, - 0x1B111B35: 0x1B12, - 0x1B3A1B35: 0x1B3B, - 0x1B3C1B35: 0x1B3D, - 0x1B3E1B35: 0x1B40, - 0x1B3F1B35: 0x1B41, - 0x1B421B35: 0x1B43, - 0x00410325: 0x1E00, - 0x00610325: 0x1E01, - 0x00420307: 0x1E02, - 0x00620307: 0x1E03, - 0x00420323: 0x1E04, - 0x00620323: 0x1E05, - 0x00420331: 0x1E06, - 0x00620331: 0x1E07, - 0x00C70301: 0x1E08, - 0x00E70301: 0x1E09, - 0x00440307: 0x1E0A, - 0x00640307: 0x1E0B, - 0x00440323: 0x1E0C, - 0x00640323: 0x1E0D, - 0x00440331: 0x1E0E, - 0x00640331: 0x1E0F, - 0x00440327: 0x1E10, - 0x00640327: 0x1E11, - 0x0044032D: 0x1E12, - 0x0064032D: 0x1E13, - 0x01120300: 0x1E14, - 0x01130300: 0x1E15, - 0x01120301: 0x1E16, - 0x01130301: 0x1E17, - 0x0045032D: 0x1E18, - 0x0065032D: 0x1E19, - 0x00450330: 0x1E1A, - 0x00650330: 0x1E1B, - 0x02280306: 0x1E1C, - 0x02290306: 0x1E1D, - 0x00460307: 0x1E1E, - 0x00660307: 0x1E1F, - 0x00470304: 0x1E20, - 0x00670304: 0x1E21, - 0x00480307: 0x1E22, - 0x00680307: 0x1E23, - 0x00480323: 0x1E24, - 0x00680323: 0x1E25, - 0x00480308: 0x1E26, - 0x00680308: 0x1E27, - 0x00480327: 0x1E28, - 0x00680327: 0x1E29, - 0x0048032E: 0x1E2A, - 0x0068032E: 0x1E2B, - 0x00490330: 0x1E2C, - 0x00690330: 0x1E2D, - 0x00CF0301: 0x1E2E, - 0x00EF0301: 0x1E2F, - 0x004B0301: 0x1E30, - 0x006B0301: 0x1E31, - 0x004B0323: 0x1E32, - 0x006B0323: 0x1E33, - 0x004B0331: 0x1E34, - 0x006B0331: 0x1E35, - 0x004C0323: 0x1E36, - 0x006C0323: 0x1E37, - 0x1E360304: 0x1E38, - 0x1E370304: 0x1E39, - 0x004C0331: 0x1E3A, - 0x006C0331: 0x1E3B, - 0x004C032D: 0x1E3C, - 0x006C032D: 0x1E3D, - 0x004D0301: 0x1E3E, - 0x006D0301: 0x1E3F, - 0x004D0307: 0x1E40, - 0x006D0307: 0x1E41, - 0x004D0323: 0x1E42, - 0x006D0323: 0x1E43, - 0x004E0307: 0x1E44, - 0x006E0307: 0x1E45, - 0x004E0323: 0x1E46, - 0x006E0323: 0x1E47, - 0x004E0331: 0x1E48, - 0x006E0331: 0x1E49, - 0x004E032D: 0x1E4A, - 0x006E032D: 0x1E4B, - 0x00D50301: 0x1E4C, - 0x00F50301: 0x1E4D, - 0x00D50308: 0x1E4E, - 0x00F50308: 0x1E4F, - 0x014C0300: 0x1E50, - 0x014D0300: 0x1E51, - 0x014C0301: 0x1E52, - 0x014D0301: 0x1E53, - 0x00500301: 0x1E54, - 0x00700301: 0x1E55, - 0x00500307: 0x1E56, - 0x00700307: 0x1E57, - 0x00520307: 0x1E58, - 0x00720307: 0x1E59, - 0x00520323: 0x1E5A, - 0x00720323: 0x1E5B, - 0x1E5A0304: 0x1E5C, - 0x1E5B0304: 0x1E5D, - 0x00520331: 0x1E5E, - 0x00720331: 0x1E5F, - 0x00530307: 0x1E60, - 0x00730307: 0x1E61, - 0x00530323: 0x1E62, - 0x00730323: 0x1E63, - 0x015A0307: 0x1E64, - 0x015B0307: 0x1E65, - 0x01600307: 0x1E66, - 0x01610307: 0x1E67, - 0x1E620307: 0x1E68, - 0x1E630307: 0x1E69, - 0x00540307: 0x1E6A, - 0x00740307: 0x1E6B, - 0x00540323: 0x1E6C, - 0x00740323: 0x1E6D, - 0x00540331: 0x1E6E, - 0x00740331: 0x1E6F, - 0x0054032D: 0x1E70, - 0x0074032D: 0x1E71, - 0x00550324: 0x1E72, - 0x00750324: 0x1E73, - 0x00550330: 0x1E74, - 0x00750330: 0x1E75, - 0x0055032D: 0x1E76, - 0x0075032D: 0x1E77, - 0x01680301: 0x1E78, - 0x01690301: 0x1E79, - 0x016A0308: 0x1E7A, - 0x016B0308: 0x1E7B, - 0x00560303: 0x1E7C, - 0x00760303: 0x1E7D, - 0x00560323: 0x1E7E, - 0x00760323: 0x1E7F, - 0x00570300: 0x1E80, - 0x00770300: 0x1E81, - 0x00570301: 0x1E82, - 0x00770301: 0x1E83, - 0x00570308: 0x1E84, - 0x00770308: 0x1E85, - 0x00570307: 0x1E86, - 0x00770307: 0x1E87, - 0x00570323: 0x1E88, - 0x00770323: 0x1E89, - 0x00580307: 0x1E8A, - 0x00780307: 0x1E8B, - 0x00580308: 0x1E8C, - 0x00780308: 0x1E8D, - 0x00590307: 0x1E8E, - 0x00790307: 0x1E8F, - 0x005A0302: 0x1E90, - 0x007A0302: 0x1E91, - 0x005A0323: 0x1E92, - 0x007A0323: 0x1E93, - 0x005A0331: 0x1E94, - 0x007A0331: 0x1E95, - 0x00680331: 0x1E96, - 0x00740308: 0x1E97, - 0x0077030A: 0x1E98, - 0x0079030A: 0x1E99, - 0x017F0307: 0x1E9B, - 0x00410323: 0x1EA0, - 0x00610323: 0x1EA1, - 0x00410309: 0x1EA2, - 0x00610309: 0x1EA3, - 0x00C20301: 0x1EA4, - 0x00E20301: 0x1EA5, - 0x00C20300: 0x1EA6, - 0x00E20300: 0x1EA7, - 0x00C20309: 0x1EA8, - 0x00E20309: 0x1EA9, - 0x00C20303: 0x1EAA, - 0x00E20303: 0x1EAB, - 0x1EA00302: 0x1EAC, - 0x1EA10302: 0x1EAD, - 0x01020301: 0x1EAE, - 0x01030301: 0x1EAF, - 0x01020300: 0x1EB0, - 0x01030300: 0x1EB1, - 0x01020309: 0x1EB2, - 0x01030309: 0x1EB3, - 0x01020303: 0x1EB4, - 0x01030303: 0x1EB5, - 0x1EA00306: 0x1EB6, - 0x1EA10306: 0x1EB7, - 0x00450323: 0x1EB8, - 0x00650323: 0x1EB9, - 0x00450309: 0x1EBA, - 0x00650309: 0x1EBB, - 0x00450303: 0x1EBC, - 0x00650303: 0x1EBD, - 0x00CA0301: 0x1EBE, - 0x00EA0301: 0x1EBF, - 0x00CA0300: 0x1EC0, - 0x00EA0300: 0x1EC1, - 0x00CA0309: 0x1EC2, - 0x00EA0309: 0x1EC3, - 0x00CA0303: 0x1EC4, - 0x00EA0303: 0x1EC5, - 0x1EB80302: 0x1EC6, - 0x1EB90302: 0x1EC7, - 0x00490309: 0x1EC8, - 0x00690309: 0x1EC9, - 0x00490323: 0x1ECA, - 0x00690323: 0x1ECB, - 0x004F0323: 0x1ECC, - 0x006F0323: 0x1ECD, - 0x004F0309: 0x1ECE, - 0x006F0309: 0x1ECF, - 0x00D40301: 0x1ED0, - 0x00F40301: 0x1ED1, - 0x00D40300: 0x1ED2, - 0x00F40300: 0x1ED3, - 0x00D40309: 0x1ED4, - 0x00F40309: 0x1ED5, - 0x00D40303: 0x1ED6, - 0x00F40303: 0x1ED7, - 0x1ECC0302: 0x1ED8, - 0x1ECD0302: 0x1ED9, - 0x01A00301: 0x1EDA, - 0x01A10301: 0x1EDB, - 0x01A00300: 0x1EDC, - 0x01A10300: 0x1EDD, - 0x01A00309: 0x1EDE, - 0x01A10309: 0x1EDF, - 0x01A00303: 0x1EE0, - 0x01A10303: 0x1EE1, - 0x01A00323: 0x1EE2, - 0x01A10323: 0x1EE3, - 0x00550323: 0x1EE4, - 0x00750323: 0x1EE5, - 0x00550309: 0x1EE6, - 0x00750309: 0x1EE7, - 0x01AF0301: 0x1EE8, - 0x01B00301: 0x1EE9, - 0x01AF0300: 0x1EEA, - 0x01B00300: 0x1EEB, - 0x01AF0309: 0x1EEC, - 0x01B00309: 0x1EED, - 0x01AF0303: 0x1EEE, - 0x01B00303: 0x1EEF, - 0x01AF0323: 0x1EF0, - 0x01B00323: 0x1EF1, - 0x00590300: 0x1EF2, - 0x00790300: 0x1EF3, - 0x00590323: 0x1EF4, - 0x00790323: 0x1EF5, - 0x00590309: 0x1EF6, - 0x00790309: 0x1EF7, - 0x00590303: 0x1EF8, - 0x00790303: 0x1EF9, - 0x03B10313: 0x1F00, - 0x03B10314: 0x1F01, - 0x1F000300: 0x1F02, - 0x1F010300: 0x1F03, - 0x1F000301: 0x1F04, - 0x1F010301: 0x1F05, - 0x1F000342: 0x1F06, - 0x1F010342: 0x1F07, - 0x03910313: 0x1F08, - 0x03910314: 0x1F09, - 0x1F080300: 0x1F0A, - 0x1F090300: 0x1F0B, - 0x1F080301: 0x1F0C, - 0x1F090301: 0x1F0D, - 0x1F080342: 0x1F0E, - 0x1F090342: 0x1F0F, - 0x03B50313: 0x1F10, - 0x03B50314: 0x1F11, - 0x1F100300: 0x1F12, - 0x1F110300: 0x1F13, - 0x1F100301: 0x1F14, - 0x1F110301: 0x1F15, - 0x03950313: 0x1F18, - 0x03950314: 0x1F19, - 0x1F180300: 0x1F1A, - 0x1F190300: 0x1F1B, - 0x1F180301: 0x1F1C, - 0x1F190301: 0x1F1D, - 0x03B70313: 0x1F20, - 0x03B70314: 0x1F21, - 0x1F200300: 0x1F22, - 0x1F210300: 0x1F23, - 0x1F200301: 0x1F24, - 0x1F210301: 0x1F25, - 0x1F200342: 0x1F26, - 0x1F210342: 0x1F27, - 0x03970313: 0x1F28, - 0x03970314: 0x1F29, - 0x1F280300: 0x1F2A, - 0x1F290300: 0x1F2B, - 0x1F280301: 0x1F2C, - 0x1F290301: 0x1F2D, - 0x1F280342: 0x1F2E, - 0x1F290342: 0x1F2F, - 0x03B90313: 0x1F30, - 0x03B90314: 0x1F31, - 0x1F300300: 0x1F32, - 0x1F310300: 0x1F33, - 0x1F300301: 0x1F34, - 0x1F310301: 0x1F35, - 0x1F300342: 0x1F36, - 0x1F310342: 0x1F37, - 0x03990313: 0x1F38, - 0x03990314: 0x1F39, - 0x1F380300: 0x1F3A, - 0x1F390300: 0x1F3B, - 0x1F380301: 0x1F3C, - 0x1F390301: 0x1F3D, - 0x1F380342: 0x1F3E, - 0x1F390342: 0x1F3F, - 0x03BF0313: 0x1F40, - 0x03BF0314: 0x1F41, - 0x1F400300: 0x1F42, - 0x1F410300: 0x1F43, - 0x1F400301: 0x1F44, - 0x1F410301: 0x1F45, - 0x039F0313: 0x1F48, - 0x039F0314: 0x1F49, - 0x1F480300: 0x1F4A, - 0x1F490300: 0x1F4B, - 0x1F480301: 0x1F4C, - 0x1F490301: 0x1F4D, - 0x03C50313: 0x1F50, - 0x03C50314: 0x1F51, - 0x1F500300: 0x1F52, - 0x1F510300: 0x1F53, - 0x1F500301: 0x1F54, - 0x1F510301: 0x1F55, - 0x1F500342: 0x1F56, - 0x1F510342: 0x1F57, - 0x03A50314: 0x1F59, - 0x1F590300: 0x1F5B, - 0x1F590301: 0x1F5D, - 0x1F590342: 0x1F5F, - 0x03C90313: 0x1F60, - 0x03C90314: 0x1F61, - 0x1F600300: 0x1F62, - 0x1F610300: 0x1F63, - 0x1F600301: 0x1F64, - 0x1F610301: 0x1F65, - 0x1F600342: 0x1F66, - 0x1F610342: 0x1F67, - 0x03A90313: 0x1F68, - 0x03A90314: 0x1F69, - 0x1F680300: 0x1F6A, - 0x1F690300: 0x1F6B, - 0x1F680301: 0x1F6C, - 0x1F690301: 0x1F6D, - 0x1F680342: 0x1F6E, - 0x1F690342: 0x1F6F, - 0x03B10300: 0x1F70, - 0x03B50300: 0x1F72, - 0x03B70300: 0x1F74, - 0x03B90300: 0x1F76, - 0x03BF0300: 0x1F78, - 0x03C50300: 0x1F7A, - 0x03C90300: 0x1F7C, - 0x1F000345: 0x1F80, - 0x1F010345: 0x1F81, - 0x1F020345: 0x1F82, - 0x1F030345: 0x1F83, - 0x1F040345: 0x1F84, - 0x1F050345: 0x1F85, - 0x1F060345: 0x1F86, - 0x1F070345: 0x1F87, - 0x1F080345: 0x1F88, - 0x1F090345: 0x1F89, - 0x1F0A0345: 0x1F8A, - 0x1F0B0345: 0x1F8B, - 0x1F0C0345: 0x1F8C, - 0x1F0D0345: 0x1F8D, - 0x1F0E0345: 0x1F8E, - 0x1F0F0345: 0x1F8F, - 0x1F200345: 0x1F90, - 0x1F210345: 0x1F91, - 0x1F220345: 0x1F92, - 0x1F230345: 0x1F93, - 0x1F240345: 0x1F94, - 0x1F250345: 0x1F95, - 0x1F260345: 0x1F96, - 0x1F270345: 0x1F97, - 0x1F280345: 0x1F98, - 0x1F290345: 0x1F99, - 0x1F2A0345: 0x1F9A, - 0x1F2B0345: 0x1F9B, - 0x1F2C0345: 0x1F9C, - 0x1F2D0345: 0x1F9D, - 0x1F2E0345: 0x1F9E, - 0x1F2F0345: 0x1F9F, - 0x1F600345: 0x1FA0, - 0x1F610345: 0x1FA1, - 0x1F620345: 0x1FA2, - 0x1F630345: 0x1FA3, - 0x1F640345: 0x1FA4, - 0x1F650345: 0x1FA5, - 0x1F660345: 0x1FA6, - 0x1F670345: 0x1FA7, - 0x1F680345: 0x1FA8, - 0x1F690345: 0x1FA9, - 0x1F6A0345: 0x1FAA, - 0x1F6B0345: 0x1FAB, - 0x1F6C0345: 0x1FAC, - 0x1F6D0345: 0x1FAD, - 0x1F6E0345: 0x1FAE, - 0x1F6F0345: 0x1FAF, - 0x03B10306: 0x1FB0, - 0x03B10304: 0x1FB1, - 0x1F700345: 0x1FB2, - 0x03B10345: 0x1FB3, - 0x03AC0345: 0x1FB4, - 0x03B10342: 0x1FB6, - 0x1FB60345: 0x1FB7, - 0x03910306: 0x1FB8, - 0x03910304: 0x1FB9, - 0x03910300: 0x1FBA, - 0x03910345: 0x1FBC, - 0x00A80342: 0x1FC1, - 0x1F740345: 0x1FC2, - 0x03B70345: 0x1FC3, - 0x03AE0345: 0x1FC4, - 0x03B70342: 0x1FC6, - 0x1FC60345: 0x1FC7, - 0x03950300: 0x1FC8, - 0x03970300: 0x1FCA, - 0x03970345: 0x1FCC, - 0x1FBF0300: 0x1FCD, - 0x1FBF0301: 0x1FCE, - 0x1FBF0342: 0x1FCF, - 0x03B90306: 0x1FD0, - 0x03B90304: 0x1FD1, - 0x03CA0300: 0x1FD2, - 0x03B90342: 0x1FD6, - 0x03CA0342: 0x1FD7, - 0x03990306: 0x1FD8, - 0x03990304: 0x1FD9, - 0x03990300: 0x1FDA, - 0x1FFE0300: 0x1FDD, - 0x1FFE0301: 0x1FDE, - 0x1FFE0342: 0x1FDF, - 0x03C50306: 0x1FE0, - 0x03C50304: 0x1FE1, - 0x03CB0300: 0x1FE2, - 0x03C10313: 0x1FE4, - 0x03C10314: 0x1FE5, - 0x03C50342: 0x1FE6, - 0x03CB0342: 0x1FE7, - 0x03A50306: 0x1FE8, - 0x03A50304: 0x1FE9, - 0x03A50300: 0x1FEA, - 0x03A10314: 0x1FEC, - 0x00A80300: 0x1FED, - 0x1F7C0345: 0x1FF2, - 0x03C90345: 0x1FF3, - 0x03CE0345: 0x1FF4, - 0x03C90342: 0x1FF6, - 0x1FF60345: 0x1FF7, - 0x039F0300: 0x1FF8, - 0x03A90300: 0x1FFA, - 0x03A90345: 0x1FFC, - 0x21900338: 0x219A, - 0x21920338: 0x219B, - 0x21940338: 0x21AE, - 0x21D00338: 0x21CD, - 0x21D40338: 0x21CE, - 0x21D20338: 0x21CF, - 0x22030338: 0x2204, - 0x22080338: 0x2209, - 0x220B0338: 0x220C, - 0x22230338: 0x2224, - 0x22250338: 0x2226, - 0x223C0338: 0x2241, - 0x22430338: 0x2244, - 0x22450338: 0x2247, - 0x22480338: 0x2249, - 0x003D0338: 0x2260, - 0x22610338: 0x2262, - 0x224D0338: 0x226D, - 0x003C0338: 0x226E, - 0x003E0338: 0x226F, - 0x22640338: 0x2270, - 0x22650338: 0x2271, - 0x22720338: 0x2274, - 0x22730338: 0x2275, - 0x22760338: 0x2278, - 0x22770338: 0x2279, - 0x227A0338: 0x2280, - 0x227B0338: 0x2281, - 0x22820338: 0x2284, - 0x22830338: 0x2285, - 0x22860338: 0x2288, - 0x22870338: 0x2289, - 0x22A20338: 0x22AC, - 0x22A80338: 0x22AD, - 0x22A90338: 0x22AE, - 0x22AB0338: 0x22AF, - 0x227C0338: 0x22E0, - 0x227D0338: 0x22E1, - 0x22910338: 0x22E2, - 0x22920338: 0x22E3, - 0x22B20338: 0x22EA, - 0x22B30338: 0x22EB, - 0x22B40338: 0x22EC, - 0x22B50338: 0x22ED, - 0x304B3099: 0x304C, - 0x304D3099: 0x304E, - 0x304F3099: 0x3050, - 0x30513099: 0x3052, - 0x30533099: 0x3054, - 0x30553099: 0x3056, - 0x30573099: 0x3058, - 0x30593099: 0x305A, - 0x305B3099: 0x305C, - 0x305D3099: 0x305E, - 0x305F3099: 0x3060, - 0x30613099: 0x3062, - 0x30643099: 0x3065, - 0x30663099: 0x3067, - 0x30683099: 0x3069, - 0x306F3099: 0x3070, - 0x306F309A: 0x3071, - 0x30723099: 0x3073, - 0x3072309A: 0x3074, - 0x30753099: 0x3076, - 0x3075309A: 0x3077, - 0x30783099: 0x3079, - 0x3078309A: 0x307A, - 0x307B3099: 0x307C, - 0x307B309A: 0x307D, - 0x30463099: 0x3094, - 0x309D3099: 0x309E, - 0x30AB3099: 0x30AC, - 0x30AD3099: 0x30AE, - 0x30AF3099: 0x30B0, - 0x30B13099: 0x30B2, - 0x30B33099: 0x30B4, - 0x30B53099: 0x30B6, - 0x30B73099: 0x30B8, - 0x30B93099: 0x30BA, - 0x30BB3099: 0x30BC, - 0x30BD3099: 0x30BE, - 0x30BF3099: 0x30C0, - 0x30C13099: 0x30C2, - 0x30C43099: 0x30C5, - 0x30C63099: 0x30C7, - 0x30C83099: 0x30C9, - 0x30CF3099: 0x30D0, - 0x30CF309A: 0x30D1, - 0x30D23099: 0x30D3, - 0x30D2309A: 0x30D4, - 0x30D53099: 0x30D6, - 0x30D5309A: 0x30D7, - 0x30D83099: 0x30D9, - 0x30D8309A: 0x30DA, - 0x30DB3099: 0x30DC, - 0x30DB309A: 0x30DD, - 0x30A63099: 0x30F4, - 0x30EF3099: 0x30F7, - 0x30F03099: 0x30F8, - 0x30F13099: 0x30F9, - 0x30F23099: 0x30FA, - 0x30FD3099: 0x30FE, - 0x109910BA: 0x1109A, - 0x109B10BA: 0x1109C, - 0x10A510BA: 0x110AB, - 0x11311127: 0x1112E, - 0x11321127: 0x1112F, - 0x1347133E: 0x1134B, - 0x13471357: 0x1134C, - 0x14B914BA: 0x114BB, - 0x14B914B0: 0x114BC, - 0x14B914BD: 0x114BE, - 0x15B815AF: 0x115BA, - 0x15B915AF: 0x115BB, -} +var recompMap map[uint32]rune +var recompMapOnce sync.Once -// Total size of tables: 53KB (54006 bytes) +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "" + // Total size of tables: 53KB (54006 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/transform.go b/vendor/golang.org/x/text/unicode/norm/transform.go index 8589067cde..a1d366ae48 100644 --- a/vendor/golang.org/x/text/unicode/norm/transform.go +++ b/vendor/golang.org/x/text/unicode/norm/transform.go @@ -18,7 +18,6 @@ func (Form) Reset() {} // Users should either catch ErrShortDst and allow dst to grow or have dst be at // least of size MaxTransformChunkSize to be guaranteed of progress. func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - n := 0 // Cap the maximum number of src bytes to check. b := src eof := atEOF @@ -27,20 +26,21 @@ func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) eof = false b = b[:ns] } - i, ok := formTable[f].quickSpan(inputBytes(b), n, len(b), eof) - n += copy(dst[n:], b[n:i]) + i, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), eof) + n := copy(dst, b[:i]) if !ok { nDst, nSrc, err = f.transform(dst[n:], src[n:], atEOF) return nDst + n, nSrc + n, err } - if n < len(src) && !atEOF { + + if err == nil && n < len(src) && !atEOF { err = transform.ErrShortSrc } return n, n, err } func flushTransform(rb *reorderBuffer) bool { - // Write out (must fully fit in dst, or else it is a ErrShortDst). + // Write out (must fully fit in dst, or else it is an ErrShortDst). if len(rb.out) < rb.nrune*utf8.UTFMax { return false } @@ -79,7 +79,7 @@ func (f Form) transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) nSrc += n nDst += n if ok { - if n < rb.nsrc && !atEOF { + if err == nil && n < rb.nsrc && !atEOF { err = transform.ErrShortSrc } return nDst, nSrc, err diff --git a/vendor/golang.org/x/text/width/BUILD b/vendor/golang.org/x/text/width/BUILD index f88c5f7953..9ff26412bd 100644 --- a/vendor/golang.org/x/text/width/BUILD +++ b/vendor/golang.org/x/text/width/BUILD @@ -4,7 +4,8 @@ go_library( name = "go_default_library", srcs = [ "kind_string.go", - "tables.go", + "tables10.0.0.go", + "tables9.0.0.go", "transform.go", "trieval.go", "width.go", diff --git a/vendor/golang.org/x/text/width/gen.go b/vendor/golang.org/x/text/width/gen.go index 03d9f99ad6..092277e1f6 100644 --- a/vendor/golang.org/x/text/width/gen.go +++ b/vendor/golang.org/x/text/width/gen.go @@ -69,7 +69,7 @@ func genTables() { fmt.Fprintf(w, "// Total table size %d bytes (%dKiB)\n", sz, sz/1024) - gen.WriteGoFile(*outputFile, "width", w.Bytes()) + gen.WriteVersionedGoFile(*outputFile, "width", w.Bytes()) } const inverseDataComment = ` diff --git a/vendor/golang.org/x/text/width/kind_string.go b/vendor/golang.org/x/text/width/kind_string.go index 49bfbf7268..edbdc54bc1 100644 --- a/vendor/golang.org/x/text/width/kind_string.go +++ b/vendor/golang.org/x/text/width/kind_string.go @@ -2,7 +2,7 @@ package width -import "fmt" +import "strconv" const _Kind_name = "NeutralEastAsianAmbiguousEastAsianWideEastAsianNarrowEastAsianFullwidthEastAsianHalfwidth" @@ -10,7 +10,7 @@ var _Kind_index = [...]uint8{0, 7, 25, 38, 53, 71, 89} func (i Kind) String() string { if i < 0 || i >= Kind(len(_Kind_index)-1) { - return fmt.Sprintf("Kind(%d)", i) + return "Kind(" + strconv.FormatInt(int64(i), 10) + ")" } return _Kind_name[_Kind_index[i]:_Kind_index[i+1]] } diff --git a/vendor/golang.org/x/text/width/tables10.0.0.go b/vendor/golang.org/x/text/width/tables10.0.0.go new file mode 100644 index 0000000000..f498862673 --- /dev/null +++ b/vendor/golang.org/x/text/width/tables10.0.0.go @@ -0,0 +1,1318 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// +build go1.10 + +package width + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "10.0.0" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// widthTrie. Total size: 14336 bytes (14.00 KiB). Checksum: c59df54630d3dc4a. +type widthTrie struct{} + +func newWidthTrie(i int) *widthTrie { + return &widthTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *widthTrie) lookupValue(n uint32, b byte) uint16 { + switch { + default: + return uint16(widthValues[n<<6+uint32(b)]) + } +} + +// widthValues: 101 blocks, 6464 entries, 12928 bytes +// The third block is the zero block. +var widthValues = [6464]uint16{ + // Block 0x0, offset 0x0 + 0x20: 0x6001, 0x21: 0x6002, 0x22: 0x6002, 0x23: 0x6002, + 0x24: 0x6002, 0x25: 0x6002, 0x26: 0x6002, 0x27: 0x6002, 0x28: 0x6002, 0x29: 0x6002, + 0x2a: 0x6002, 0x2b: 0x6002, 0x2c: 0x6002, 0x2d: 0x6002, 0x2e: 0x6002, 0x2f: 0x6002, + 0x30: 0x6002, 0x31: 0x6002, 0x32: 0x6002, 0x33: 0x6002, 0x34: 0x6002, 0x35: 0x6002, + 0x36: 0x6002, 0x37: 0x6002, 0x38: 0x6002, 0x39: 0x6002, 0x3a: 0x6002, 0x3b: 0x6002, + 0x3c: 0x6002, 0x3d: 0x6002, 0x3e: 0x6002, 0x3f: 0x6002, + // Block 0x1, offset 0x40 + 0x40: 0x6003, 0x41: 0x6003, 0x42: 0x6003, 0x43: 0x6003, 0x44: 0x6003, 0x45: 0x6003, + 0x46: 0x6003, 0x47: 0x6003, 0x48: 0x6003, 0x49: 0x6003, 0x4a: 0x6003, 0x4b: 0x6003, + 0x4c: 0x6003, 0x4d: 0x6003, 0x4e: 0x6003, 0x4f: 0x6003, 0x50: 0x6003, 0x51: 0x6003, + 0x52: 0x6003, 0x53: 0x6003, 0x54: 0x6003, 0x55: 0x6003, 0x56: 0x6003, 0x57: 0x6003, + 0x58: 0x6003, 0x59: 0x6003, 0x5a: 0x6003, 0x5b: 0x6003, 0x5c: 0x6003, 0x5d: 0x6003, + 0x5e: 0x6003, 0x5f: 0x6003, 0x60: 0x6004, 0x61: 0x6004, 0x62: 0x6004, 0x63: 0x6004, + 0x64: 0x6004, 0x65: 0x6004, 0x66: 0x6004, 0x67: 0x6004, 0x68: 0x6004, 0x69: 0x6004, + 0x6a: 0x6004, 0x6b: 0x6004, 0x6c: 0x6004, 0x6d: 0x6004, 0x6e: 0x6004, 0x6f: 0x6004, + 0x70: 0x6004, 0x71: 0x6004, 0x72: 0x6004, 0x73: 0x6004, 0x74: 0x6004, 0x75: 0x6004, + 0x76: 0x6004, 0x77: 0x6004, 0x78: 0x6004, 0x79: 0x6004, 0x7a: 0x6004, 0x7b: 0x6004, + 0x7c: 0x6004, 0x7d: 0x6004, 0x7e: 0x6004, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xe1: 0x2000, 0xe2: 0x6005, 0xe3: 0x6005, + 0xe4: 0x2000, 0xe5: 0x6006, 0xe6: 0x6005, 0xe7: 0x2000, 0xe8: 0x2000, + 0xea: 0x2000, 0xec: 0x6007, 0xed: 0x2000, 0xee: 0x2000, 0xef: 0x6008, + 0xf0: 0x2000, 0xf1: 0x2000, 0xf2: 0x2000, 0xf3: 0x2000, 0xf4: 0x2000, + 0xf6: 0x2000, 0xf7: 0x2000, 0xf8: 0x2000, 0xf9: 0x2000, 0xfa: 0x2000, + 0xfc: 0x2000, 0xfd: 0x2000, 0xfe: 0x2000, 0xff: 0x2000, + // Block 0x4, offset 0x100 + 0x106: 0x2000, + 0x110: 0x2000, + 0x117: 0x2000, + 0x118: 0x2000, + 0x11e: 0x2000, 0x11f: 0x2000, 0x120: 0x2000, 0x121: 0x2000, + 0x126: 0x2000, 0x128: 0x2000, 0x129: 0x2000, + 0x12a: 0x2000, 0x12c: 0x2000, 0x12d: 0x2000, + 0x130: 0x2000, 0x132: 0x2000, 0x133: 0x2000, + 0x137: 0x2000, 0x138: 0x2000, 0x139: 0x2000, 0x13a: 0x2000, + 0x13c: 0x2000, 0x13e: 0x2000, + // Block 0x5, offset 0x140 + 0x141: 0x2000, + 0x151: 0x2000, + 0x153: 0x2000, + 0x15b: 0x2000, + 0x166: 0x2000, 0x167: 0x2000, + 0x16b: 0x2000, + 0x171: 0x2000, 0x172: 0x2000, 0x173: 0x2000, + 0x178: 0x2000, + 0x17f: 0x2000, + // Block 0x6, offset 0x180 + 0x180: 0x2000, 0x181: 0x2000, 0x182: 0x2000, 0x184: 0x2000, + 0x188: 0x2000, 0x189: 0x2000, 0x18a: 0x2000, 0x18b: 0x2000, + 0x18d: 0x2000, + 0x192: 0x2000, 0x193: 0x2000, + 0x1a6: 0x2000, 0x1a7: 0x2000, + 0x1ab: 0x2000, + // Block 0x7, offset 0x1c0 + 0x1ce: 0x2000, 0x1d0: 0x2000, + 0x1d2: 0x2000, 0x1d4: 0x2000, 0x1d6: 0x2000, + 0x1d8: 0x2000, 0x1da: 0x2000, 0x1dc: 0x2000, + // Block 0x8, offset 0x200 + 0x211: 0x2000, + 0x221: 0x2000, + // Block 0x9, offset 0x240 + 0x244: 0x2000, + 0x247: 0x2000, 0x249: 0x2000, 0x24a: 0x2000, 0x24b: 0x2000, + 0x24d: 0x2000, 0x250: 0x2000, + 0x258: 0x2000, 0x259: 0x2000, 0x25a: 0x2000, 0x25b: 0x2000, 0x25d: 0x2000, + 0x25f: 0x2000, + // Block 0xa, offset 0x280 + 0x280: 0x2000, 0x281: 0x2000, 0x282: 0x2000, 0x283: 0x2000, 0x284: 0x2000, 0x285: 0x2000, + 0x286: 0x2000, 0x287: 0x2000, 0x288: 0x2000, 0x289: 0x2000, 0x28a: 0x2000, 0x28b: 0x2000, + 0x28c: 0x2000, 0x28d: 0x2000, 0x28e: 0x2000, 0x28f: 0x2000, 0x290: 0x2000, 0x291: 0x2000, + 0x292: 0x2000, 0x293: 0x2000, 0x294: 0x2000, 0x295: 0x2000, 0x296: 0x2000, 0x297: 0x2000, + 0x298: 0x2000, 0x299: 0x2000, 0x29a: 0x2000, 0x29b: 0x2000, 0x29c: 0x2000, 0x29d: 0x2000, + 0x29e: 0x2000, 0x29f: 0x2000, 0x2a0: 0x2000, 0x2a1: 0x2000, 0x2a2: 0x2000, 0x2a3: 0x2000, + 0x2a4: 0x2000, 0x2a5: 0x2000, 0x2a6: 0x2000, 0x2a7: 0x2000, 0x2a8: 0x2000, 0x2a9: 0x2000, + 0x2aa: 0x2000, 0x2ab: 0x2000, 0x2ac: 0x2000, 0x2ad: 0x2000, 0x2ae: 0x2000, 0x2af: 0x2000, + 0x2b0: 0x2000, 0x2b1: 0x2000, 0x2b2: 0x2000, 0x2b3: 0x2000, 0x2b4: 0x2000, 0x2b5: 0x2000, + 0x2b6: 0x2000, 0x2b7: 0x2000, 0x2b8: 0x2000, 0x2b9: 0x2000, 0x2ba: 0x2000, 0x2bb: 0x2000, + 0x2bc: 0x2000, 0x2bd: 0x2000, 0x2be: 0x2000, 0x2bf: 0x2000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x2000, 0x2c1: 0x2000, 0x2c2: 0x2000, 0x2c3: 0x2000, 0x2c4: 0x2000, 0x2c5: 0x2000, + 0x2c6: 0x2000, 0x2c7: 0x2000, 0x2c8: 0x2000, 0x2c9: 0x2000, 0x2ca: 0x2000, 0x2cb: 0x2000, + 0x2cc: 0x2000, 0x2cd: 0x2000, 0x2ce: 0x2000, 0x2cf: 0x2000, 0x2d0: 0x2000, 0x2d1: 0x2000, + 0x2d2: 0x2000, 0x2d3: 0x2000, 0x2d4: 0x2000, 0x2d5: 0x2000, 0x2d6: 0x2000, 0x2d7: 0x2000, + 0x2d8: 0x2000, 0x2d9: 0x2000, 0x2da: 0x2000, 0x2db: 0x2000, 0x2dc: 0x2000, 0x2dd: 0x2000, + 0x2de: 0x2000, 0x2df: 0x2000, 0x2e0: 0x2000, 0x2e1: 0x2000, 0x2e2: 0x2000, 0x2e3: 0x2000, + 0x2e4: 0x2000, 0x2e5: 0x2000, 0x2e6: 0x2000, 0x2e7: 0x2000, 0x2e8: 0x2000, 0x2e9: 0x2000, + 0x2ea: 0x2000, 0x2eb: 0x2000, 0x2ec: 0x2000, 0x2ed: 0x2000, 0x2ee: 0x2000, 0x2ef: 0x2000, + // Block 0xc, offset 0x300 + 0x311: 0x2000, + 0x312: 0x2000, 0x313: 0x2000, 0x314: 0x2000, 0x315: 0x2000, 0x316: 0x2000, 0x317: 0x2000, + 0x318: 0x2000, 0x319: 0x2000, 0x31a: 0x2000, 0x31b: 0x2000, 0x31c: 0x2000, 0x31d: 0x2000, + 0x31e: 0x2000, 0x31f: 0x2000, 0x320: 0x2000, 0x321: 0x2000, 0x323: 0x2000, + 0x324: 0x2000, 0x325: 0x2000, 0x326: 0x2000, 0x327: 0x2000, 0x328: 0x2000, 0x329: 0x2000, + 0x331: 0x2000, 0x332: 0x2000, 0x333: 0x2000, 0x334: 0x2000, 0x335: 0x2000, + 0x336: 0x2000, 0x337: 0x2000, 0x338: 0x2000, 0x339: 0x2000, 0x33a: 0x2000, 0x33b: 0x2000, + 0x33c: 0x2000, 0x33d: 0x2000, 0x33e: 0x2000, 0x33f: 0x2000, + // Block 0xd, offset 0x340 + 0x340: 0x2000, 0x341: 0x2000, 0x343: 0x2000, 0x344: 0x2000, 0x345: 0x2000, + 0x346: 0x2000, 0x347: 0x2000, 0x348: 0x2000, 0x349: 0x2000, + // Block 0xe, offset 0x380 + 0x381: 0x2000, + 0x390: 0x2000, 0x391: 0x2000, + 0x392: 0x2000, 0x393: 0x2000, 0x394: 0x2000, 0x395: 0x2000, 0x396: 0x2000, 0x397: 0x2000, + 0x398: 0x2000, 0x399: 0x2000, 0x39a: 0x2000, 0x39b: 0x2000, 0x39c: 0x2000, 0x39d: 0x2000, + 0x39e: 0x2000, 0x39f: 0x2000, 0x3a0: 0x2000, 0x3a1: 0x2000, 0x3a2: 0x2000, 0x3a3: 0x2000, + 0x3a4: 0x2000, 0x3a5: 0x2000, 0x3a6: 0x2000, 0x3a7: 0x2000, 0x3a8: 0x2000, 0x3a9: 0x2000, + 0x3aa: 0x2000, 0x3ab: 0x2000, 0x3ac: 0x2000, 0x3ad: 0x2000, 0x3ae: 0x2000, 0x3af: 0x2000, + 0x3b0: 0x2000, 0x3b1: 0x2000, 0x3b2: 0x2000, 0x3b3: 0x2000, 0x3b4: 0x2000, 0x3b5: 0x2000, + 0x3b6: 0x2000, 0x3b7: 0x2000, 0x3b8: 0x2000, 0x3b9: 0x2000, 0x3ba: 0x2000, 0x3bb: 0x2000, + 0x3bc: 0x2000, 0x3bd: 0x2000, 0x3be: 0x2000, 0x3bf: 0x2000, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x2000, 0x3c1: 0x2000, 0x3c2: 0x2000, 0x3c3: 0x2000, 0x3c4: 0x2000, 0x3c5: 0x2000, + 0x3c6: 0x2000, 0x3c7: 0x2000, 0x3c8: 0x2000, 0x3c9: 0x2000, 0x3ca: 0x2000, 0x3cb: 0x2000, + 0x3cc: 0x2000, 0x3cd: 0x2000, 0x3ce: 0x2000, 0x3cf: 0x2000, 0x3d1: 0x2000, + // Block 0x10, offset 0x400 + 0x400: 0x4000, 0x401: 0x4000, 0x402: 0x4000, 0x403: 0x4000, 0x404: 0x4000, 0x405: 0x4000, + 0x406: 0x4000, 0x407: 0x4000, 0x408: 0x4000, 0x409: 0x4000, 0x40a: 0x4000, 0x40b: 0x4000, + 0x40c: 0x4000, 0x40d: 0x4000, 0x40e: 0x4000, 0x40f: 0x4000, 0x410: 0x4000, 0x411: 0x4000, + 0x412: 0x4000, 0x413: 0x4000, 0x414: 0x4000, 0x415: 0x4000, 0x416: 0x4000, 0x417: 0x4000, + 0x418: 0x4000, 0x419: 0x4000, 0x41a: 0x4000, 0x41b: 0x4000, 0x41c: 0x4000, 0x41d: 0x4000, + 0x41e: 0x4000, 0x41f: 0x4000, 0x420: 0x4000, 0x421: 0x4000, 0x422: 0x4000, 0x423: 0x4000, + 0x424: 0x4000, 0x425: 0x4000, 0x426: 0x4000, 0x427: 0x4000, 0x428: 0x4000, 0x429: 0x4000, + 0x42a: 0x4000, 0x42b: 0x4000, 0x42c: 0x4000, 0x42d: 0x4000, 0x42e: 0x4000, 0x42f: 0x4000, + 0x430: 0x4000, 0x431: 0x4000, 0x432: 0x4000, 0x433: 0x4000, 0x434: 0x4000, 0x435: 0x4000, + 0x436: 0x4000, 0x437: 0x4000, 0x438: 0x4000, 0x439: 0x4000, 0x43a: 0x4000, 0x43b: 0x4000, + 0x43c: 0x4000, 0x43d: 0x4000, 0x43e: 0x4000, 0x43f: 0x4000, + // Block 0x11, offset 0x440 + 0x440: 0x4000, 0x441: 0x4000, 0x442: 0x4000, 0x443: 0x4000, 0x444: 0x4000, 0x445: 0x4000, + 0x446: 0x4000, 0x447: 0x4000, 0x448: 0x4000, 0x449: 0x4000, 0x44a: 0x4000, 0x44b: 0x4000, + 0x44c: 0x4000, 0x44d: 0x4000, 0x44e: 0x4000, 0x44f: 0x4000, 0x450: 0x4000, 0x451: 0x4000, + 0x452: 0x4000, 0x453: 0x4000, 0x454: 0x4000, 0x455: 0x4000, 0x456: 0x4000, 0x457: 0x4000, + 0x458: 0x4000, 0x459: 0x4000, 0x45a: 0x4000, 0x45b: 0x4000, 0x45c: 0x4000, 0x45d: 0x4000, + 0x45e: 0x4000, 0x45f: 0x4000, + // Block 0x12, offset 0x480 + 0x490: 0x2000, + 0x493: 0x2000, 0x494: 0x2000, 0x495: 0x2000, 0x496: 0x2000, + 0x498: 0x2000, 0x499: 0x2000, 0x49c: 0x2000, 0x49d: 0x2000, + 0x4a0: 0x2000, 0x4a1: 0x2000, 0x4a2: 0x2000, + 0x4a4: 0x2000, 0x4a5: 0x2000, 0x4a6: 0x2000, 0x4a7: 0x2000, + 0x4b0: 0x2000, 0x4b2: 0x2000, 0x4b3: 0x2000, 0x4b5: 0x2000, + 0x4bb: 0x2000, + 0x4be: 0x2000, + // Block 0x13, offset 0x4c0 + 0x4f4: 0x2000, + 0x4ff: 0x2000, + // Block 0x14, offset 0x500 + 0x501: 0x2000, 0x502: 0x2000, 0x503: 0x2000, 0x504: 0x2000, + 0x529: 0xa009, + 0x52c: 0x2000, + // Block 0x15, offset 0x540 + 0x543: 0x2000, 0x545: 0x2000, + 0x549: 0x2000, + 0x553: 0x2000, 0x556: 0x2000, + 0x561: 0x2000, 0x562: 0x2000, + 0x566: 0x2000, + 0x56b: 0x2000, + // Block 0x16, offset 0x580 + 0x593: 0x2000, 0x594: 0x2000, + 0x59b: 0x2000, 0x59c: 0x2000, 0x59d: 0x2000, + 0x59e: 0x2000, 0x5a0: 0x2000, 0x5a1: 0x2000, 0x5a2: 0x2000, 0x5a3: 0x2000, + 0x5a4: 0x2000, 0x5a5: 0x2000, 0x5a6: 0x2000, 0x5a7: 0x2000, 0x5a8: 0x2000, 0x5a9: 0x2000, + 0x5aa: 0x2000, 0x5ab: 0x2000, + 0x5b0: 0x2000, 0x5b1: 0x2000, 0x5b2: 0x2000, 0x5b3: 0x2000, 0x5b4: 0x2000, 0x5b5: 0x2000, + 0x5b6: 0x2000, 0x5b7: 0x2000, 0x5b8: 0x2000, 0x5b9: 0x2000, + // Block 0x17, offset 0x5c0 + 0x5c9: 0x2000, + 0x5d0: 0x200a, 0x5d1: 0x200b, + 0x5d2: 0x200a, 0x5d3: 0x200c, 0x5d4: 0x2000, 0x5d5: 0x2000, 0x5d6: 0x2000, 0x5d7: 0x2000, + 0x5d8: 0x2000, 0x5d9: 0x2000, + 0x5f8: 0x2000, 0x5f9: 0x2000, + // Block 0x18, offset 0x600 + 0x612: 0x2000, 0x614: 0x2000, + 0x627: 0x2000, + // Block 0x19, offset 0x640 + 0x640: 0x2000, 0x642: 0x2000, 0x643: 0x2000, + 0x647: 0x2000, 0x648: 0x2000, 0x64b: 0x2000, + 0x64f: 0x2000, 0x651: 0x2000, + 0x655: 0x2000, + 0x65a: 0x2000, 0x65d: 0x2000, + 0x65e: 0x2000, 0x65f: 0x2000, 0x660: 0x2000, 0x663: 0x2000, + 0x665: 0x2000, 0x667: 0x2000, 0x668: 0x2000, 0x669: 0x2000, + 0x66a: 0x2000, 0x66b: 0x2000, 0x66c: 0x2000, 0x66e: 0x2000, + 0x674: 0x2000, 0x675: 0x2000, + 0x676: 0x2000, 0x677: 0x2000, + 0x67c: 0x2000, 0x67d: 0x2000, + // Block 0x1a, offset 0x680 + 0x688: 0x2000, + 0x68c: 0x2000, + 0x692: 0x2000, + 0x6a0: 0x2000, 0x6a1: 0x2000, + 0x6a4: 0x2000, 0x6a5: 0x2000, 0x6a6: 0x2000, 0x6a7: 0x2000, + 0x6aa: 0x2000, 0x6ab: 0x2000, 0x6ae: 0x2000, 0x6af: 0x2000, + // Block 0x1b, offset 0x6c0 + 0x6c2: 0x2000, 0x6c3: 0x2000, + 0x6c6: 0x2000, 0x6c7: 0x2000, + 0x6d5: 0x2000, + 0x6d9: 0x2000, + 0x6e5: 0x2000, + 0x6ff: 0x2000, + // Block 0x1c, offset 0x700 + 0x712: 0x2000, + 0x71a: 0x4000, 0x71b: 0x4000, + 0x729: 0x4000, + 0x72a: 0x4000, + // Block 0x1d, offset 0x740 + 0x769: 0x4000, + 0x76a: 0x4000, 0x76b: 0x4000, 0x76c: 0x4000, + 0x770: 0x4000, 0x773: 0x4000, + // Block 0x1e, offset 0x780 + 0x7a0: 0x2000, 0x7a1: 0x2000, 0x7a2: 0x2000, 0x7a3: 0x2000, + 0x7a4: 0x2000, 0x7a5: 0x2000, 0x7a6: 0x2000, 0x7a7: 0x2000, 0x7a8: 0x2000, 0x7a9: 0x2000, + 0x7aa: 0x2000, 0x7ab: 0x2000, 0x7ac: 0x2000, 0x7ad: 0x2000, 0x7ae: 0x2000, 0x7af: 0x2000, + 0x7b0: 0x2000, 0x7b1: 0x2000, 0x7b2: 0x2000, 0x7b3: 0x2000, 0x7b4: 0x2000, 0x7b5: 0x2000, + 0x7b6: 0x2000, 0x7b7: 0x2000, 0x7b8: 0x2000, 0x7b9: 0x2000, 0x7ba: 0x2000, 0x7bb: 0x2000, + 0x7bc: 0x2000, 0x7bd: 0x2000, 0x7be: 0x2000, 0x7bf: 0x2000, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x2000, 0x7c1: 0x2000, 0x7c2: 0x2000, 0x7c3: 0x2000, 0x7c4: 0x2000, 0x7c5: 0x2000, + 0x7c6: 0x2000, 0x7c7: 0x2000, 0x7c8: 0x2000, 0x7c9: 0x2000, 0x7ca: 0x2000, 0x7cb: 0x2000, + 0x7cc: 0x2000, 0x7cd: 0x2000, 0x7ce: 0x2000, 0x7cf: 0x2000, 0x7d0: 0x2000, 0x7d1: 0x2000, + 0x7d2: 0x2000, 0x7d3: 0x2000, 0x7d4: 0x2000, 0x7d5: 0x2000, 0x7d6: 0x2000, 0x7d7: 0x2000, + 0x7d8: 0x2000, 0x7d9: 0x2000, 0x7da: 0x2000, 0x7db: 0x2000, 0x7dc: 0x2000, 0x7dd: 0x2000, + 0x7de: 0x2000, 0x7df: 0x2000, 0x7e0: 0x2000, 0x7e1: 0x2000, 0x7e2: 0x2000, 0x7e3: 0x2000, + 0x7e4: 0x2000, 0x7e5: 0x2000, 0x7e6: 0x2000, 0x7e7: 0x2000, 0x7e8: 0x2000, 0x7e9: 0x2000, + 0x7eb: 0x2000, 0x7ec: 0x2000, 0x7ed: 0x2000, 0x7ee: 0x2000, 0x7ef: 0x2000, + 0x7f0: 0x2000, 0x7f1: 0x2000, 0x7f2: 0x2000, 0x7f3: 0x2000, 0x7f4: 0x2000, 0x7f5: 0x2000, + 0x7f6: 0x2000, 0x7f7: 0x2000, 0x7f8: 0x2000, 0x7f9: 0x2000, 0x7fa: 0x2000, 0x7fb: 0x2000, + 0x7fc: 0x2000, 0x7fd: 0x2000, 0x7fe: 0x2000, 0x7ff: 0x2000, + // Block 0x20, offset 0x800 + 0x800: 0x2000, 0x801: 0x2000, 0x802: 0x200d, 0x803: 0x2000, 0x804: 0x2000, 0x805: 0x2000, + 0x806: 0x2000, 0x807: 0x2000, 0x808: 0x2000, 0x809: 0x2000, 0x80a: 0x2000, 0x80b: 0x2000, + 0x80c: 0x2000, 0x80d: 0x2000, 0x80e: 0x2000, 0x80f: 0x2000, 0x810: 0x2000, 0x811: 0x2000, + 0x812: 0x2000, 0x813: 0x2000, 0x814: 0x2000, 0x815: 0x2000, 0x816: 0x2000, 0x817: 0x2000, + 0x818: 0x2000, 0x819: 0x2000, 0x81a: 0x2000, 0x81b: 0x2000, 0x81c: 0x2000, 0x81d: 0x2000, + 0x81e: 0x2000, 0x81f: 0x2000, 0x820: 0x2000, 0x821: 0x2000, 0x822: 0x2000, 0x823: 0x2000, + 0x824: 0x2000, 0x825: 0x2000, 0x826: 0x2000, 0x827: 0x2000, 0x828: 0x2000, 0x829: 0x2000, + 0x82a: 0x2000, 0x82b: 0x2000, 0x82c: 0x2000, 0x82d: 0x2000, 0x82e: 0x2000, 0x82f: 0x2000, + 0x830: 0x2000, 0x831: 0x2000, 0x832: 0x2000, 0x833: 0x2000, 0x834: 0x2000, 0x835: 0x2000, + 0x836: 0x2000, 0x837: 0x2000, 0x838: 0x2000, 0x839: 0x2000, 0x83a: 0x2000, 0x83b: 0x2000, + 0x83c: 0x2000, 0x83d: 0x2000, 0x83e: 0x2000, 0x83f: 0x2000, + // Block 0x21, offset 0x840 + 0x840: 0x2000, 0x841: 0x2000, 0x842: 0x2000, 0x843: 0x2000, 0x844: 0x2000, 0x845: 0x2000, + 0x846: 0x2000, 0x847: 0x2000, 0x848: 0x2000, 0x849: 0x2000, 0x84a: 0x2000, 0x84b: 0x2000, + 0x850: 0x2000, 0x851: 0x2000, + 0x852: 0x2000, 0x853: 0x2000, 0x854: 0x2000, 0x855: 0x2000, 0x856: 0x2000, 0x857: 0x2000, + 0x858: 0x2000, 0x859: 0x2000, 0x85a: 0x2000, 0x85b: 0x2000, 0x85c: 0x2000, 0x85d: 0x2000, + 0x85e: 0x2000, 0x85f: 0x2000, 0x860: 0x2000, 0x861: 0x2000, 0x862: 0x2000, 0x863: 0x2000, + 0x864: 0x2000, 0x865: 0x2000, 0x866: 0x2000, 0x867: 0x2000, 0x868: 0x2000, 0x869: 0x2000, + 0x86a: 0x2000, 0x86b: 0x2000, 0x86c: 0x2000, 0x86d: 0x2000, 0x86e: 0x2000, 0x86f: 0x2000, + 0x870: 0x2000, 0x871: 0x2000, 0x872: 0x2000, 0x873: 0x2000, + // Block 0x22, offset 0x880 + 0x880: 0x2000, 0x881: 0x2000, 0x882: 0x2000, 0x883: 0x2000, 0x884: 0x2000, 0x885: 0x2000, + 0x886: 0x2000, 0x887: 0x2000, 0x888: 0x2000, 0x889: 0x2000, 0x88a: 0x2000, 0x88b: 0x2000, + 0x88c: 0x2000, 0x88d: 0x2000, 0x88e: 0x2000, 0x88f: 0x2000, + 0x892: 0x2000, 0x893: 0x2000, 0x894: 0x2000, 0x895: 0x2000, + 0x8a0: 0x200e, 0x8a1: 0x2000, 0x8a3: 0x2000, + 0x8a4: 0x2000, 0x8a5: 0x2000, 0x8a6: 0x2000, 0x8a7: 0x2000, 0x8a8: 0x2000, 0x8a9: 0x2000, + 0x8b2: 0x2000, 0x8b3: 0x2000, + 0x8b6: 0x2000, 0x8b7: 0x2000, + 0x8bc: 0x2000, 0x8bd: 0x2000, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x2000, 0x8c1: 0x2000, + 0x8c6: 0x2000, 0x8c7: 0x2000, 0x8c8: 0x2000, 0x8cb: 0x200f, + 0x8ce: 0x2000, 0x8cf: 0x2000, 0x8d0: 0x2000, 0x8d1: 0x2000, + 0x8e2: 0x2000, 0x8e3: 0x2000, + 0x8e4: 0x2000, 0x8e5: 0x2000, + 0x8ef: 0x2000, + 0x8fd: 0x4000, 0x8fe: 0x4000, + // Block 0x24, offset 0x900 + 0x905: 0x2000, + 0x906: 0x2000, 0x909: 0x2000, + 0x90e: 0x2000, 0x90f: 0x2000, + 0x914: 0x4000, 0x915: 0x4000, + 0x91c: 0x2000, + 0x91e: 0x2000, + // Block 0x25, offset 0x940 + 0x940: 0x2000, 0x942: 0x2000, + 0x948: 0x4000, 0x949: 0x4000, 0x94a: 0x4000, 0x94b: 0x4000, + 0x94c: 0x4000, 0x94d: 0x4000, 0x94e: 0x4000, 0x94f: 0x4000, 0x950: 0x4000, 0x951: 0x4000, + 0x952: 0x4000, 0x953: 0x4000, + 0x960: 0x2000, 0x961: 0x2000, 0x963: 0x2000, + 0x964: 0x2000, 0x965: 0x2000, 0x967: 0x2000, 0x968: 0x2000, 0x969: 0x2000, + 0x96a: 0x2000, 0x96c: 0x2000, 0x96d: 0x2000, 0x96f: 0x2000, + 0x97f: 0x4000, + // Block 0x26, offset 0x980 + 0x993: 0x4000, + 0x99e: 0x2000, 0x99f: 0x2000, 0x9a1: 0x4000, + 0x9aa: 0x4000, 0x9ab: 0x4000, + 0x9bd: 0x4000, 0x9be: 0x4000, 0x9bf: 0x2000, + // Block 0x27, offset 0x9c0 + 0x9c4: 0x4000, 0x9c5: 0x4000, + 0x9c6: 0x2000, 0x9c7: 0x2000, 0x9c8: 0x2000, 0x9c9: 0x2000, 0x9ca: 0x2000, 0x9cb: 0x2000, + 0x9cc: 0x2000, 0x9cd: 0x2000, 0x9ce: 0x4000, 0x9cf: 0x2000, 0x9d0: 0x2000, 0x9d1: 0x2000, + 0x9d2: 0x2000, 0x9d3: 0x2000, 0x9d4: 0x4000, 0x9d5: 0x2000, 0x9d6: 0x2000, 0x9d7: 0x2000, + 0x9d8: 0x2000, 0x9d9: 0x2000, 0x9da: 0x2000, 0x9db: 0x2000, 0x9dc: 0x2000, 0x9dd: 0x2000, + 0x9de: 0x2000, 0x9df: 0x2000, 0x9e0: 0x2000, 0x9e1: 0x2000, 0x9e3: 0x2000, + 0x9e8: 0x2000, 0x9e9: 0x2000, + 0x9ea: 0x4000, 0x9eb: 0x2000, 0x9ec: 0x2000, 0x9ed: 0x2000, 0x9ee: 0x2000, 0x9ef: 0x2000, + 0x9f0: 0x2000, 0x9f1: 0x2000, 0x9f2: 0x4000, 0x9f3: 0x4000, 0x9f4: 0x2000, 0x9f5: 0x4000, + 0x9f6: 0x2000, 0x9f7: 0x2000, 0x9f8: 0x2000, 0x9f9: 0x2000, 0x9fa: 0x4000, 0x9fb: 0x2000, + 0x9fc: 0x2000, 0x9fd: 0x4000, 0x9fe: 0x2000, 0x9ff: 0x2000, + // Block 0x28, offset 0xa00 + 0xa05: 0x4000, + 0xa0a: 0x4000, 0xa0b: 0x4000, + 0xa28: 0x4000, + 0xa3d: 0x2000, + // Block 0x29, offset 0xa40 + 0xa4c: 0x4000, 0xa4e: 0x4000, + 0xa53: 0x4000, 0xa54: 0x4000, 0xa55: 0x4000, 0xa57: 0x4000, + 0xa76: 0x2000, 0xa77: 0x2000, 0xa78: 0x2000, 0xa79: 0x2000, 0xa7a: 0x2000, 0xa7b: 0x2000, + 0xa7c: 0x2000, 0xa7d: 0x2000, 0xa7e: 0x2000, 0xa7f: 0x2000, + // Block 0x2a, offset 0xa80 + 0xa95: 0x4000, 0xa96: 0x4000, 0xa97: 0x4000, + 0xab0: 0x4000, + 0xabf: 0x4000, + // Block 0x2b, offset 0xac0 + 0xae6: 0x6000, 0xae7: 0x6000, 0xae8: 0x6000, 0xae9: 0x6000, + 0xaea: 0x6000, 0xaeb: 0x6000, 0xaec: 0x6000, 0xaed: 0x6000, + // Block 0x2c, offset 0xb00 + 0xb05: 0x6010, + 0xb06: 0x6011, + // Block 0x2d, offset 0xb40 + 0xb5b: 0x4000, 0xb5c: 0x4000, + // Block 0x2e, offset 0xb80 + 0xb90: 0x4000, + 0xb95: 0x4000, 0xb96: 0x2000, 0xb97: 0x2000, + 0xb98: 0x2000, 0xb99: 0x2000, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x4000, 0xbc1: 0x4000, 0xbc2: 0x4000, 0xbc3: 0x4000, 0xbc4: 0x4000, 0xbc5: 0x4000, + 0xbc6: 0x4000, 0xbc7: 0x4000, 0xbc8: 0x4000, 0xbc9: 0x4000, 0xbca: 0x4000, 0xbcb: 0x4000, + 0xbcc: 0x4000, 0xbcd: 0x4000, 0xbce: 0x4000, 0xbcf: 0x4000, 0xbd0: 0x4000, 0xbd1: 0x4000, + 0xbd2: 0x4000, 0xbd3: 0x4000, 0xbd4: 0x4000, 0xbd5: 0x4000, 0xbd6: 0x4000, 0xbd7: 0x4000, + 0xbd8: 0x4000, 0xbd9: 0x4000, 0xbdb: 0x4000, 0xbdc: 0x4000, 0xbdd: 0x4000, + 0xbde: 0x4000, 0xbdf: 0x4000, 0xbe0: 0x4000, 0xbe1: 0x4000, 0xbe2: 0x4000, 0xbe3: 0x4000, + 0xbe4: 0x4000, 0xbe5: 0x4000, 0xbe6: 0x4000, 0xbe7: 0x4000, 0xbe8: 0x4000, 0xbe9: 0x4000, + 0xbea: 0x4000, 0xbeb: 0x4000, 0xbec: 0x4000, 0xbed: 0x4000, 0xbee: 0x4000, 0xbef: 0x4000, + 0xbf0: 0x4000, 0xbf1: 0x4000, 0xbf2: 0x4000, 0xbf3: 0x4000, 0xbf4: 0x4000, 0xbf5: 0x4000, + 0xbf6: 0x4000, 0xbf7: 0x4000, 0xbf8: 0x4000, 0xbf9: 0x4000, 0xbfa: 0x4000, 0xbfb: 0x4000, + 0xbfc: 0x4000, 0xbfd: 0x4000, 0xbfe: 0x4000, 0xbff: 0x4000, + // Block 0x30, offset 0xc00 + 0xc00: 0x4000, 0xc01: 0x4000, 0xc02: 0x4000, 0xc03: 0x4000, 0xc04: 0x4000, 0xc05: 0x4000, + 0xc06: 0x4000, 0xc07: 0x4000, 0xc08: 0x4000, 0xc09: 0x4000, 0xc0a: 0x4000, 0xc0b: 0x4000, + 0xc0c: 0x4000, 0xc0d: 0x4000, 0xc0e: 0x4000, 0xc0f: 0x4000, 0xc10: 0x4000, 0xc11: 0x4000, + 0xc12: 0x4000, 0xc13: 0x4000, 0xc14: 0x4000, 0xc15: 0x4000, 0xc16: 0x4000, 0xc17: 0x4000, + 0xc18: 0x4000, 0xc19: 0x4000, 0xc1a: 0x4000, 0xc1b: 0x4000, 0xc1c: 0x4000, 0xc1d: 0x4000, + 0xc1e: 0x4000, 0xc1f: 0x4000, 0xc20: 0x4000, 0xc21: 0x4000, 0xc22: 0x4000, 0xc23: 0x4000, + 0xc24: 0x4000, 0xc25: 0x4000, 0xc26: 0x4000, 0xc27: 0x4000, 0xc28: 0x4000, 0xc29: 0x4000, + 0xc2a: 0x4000, 0xc2b: 0x4000, 0xc2c: 0x4000, 0xc2d: 0x4000, 0xc2e: 0x4000, 0xc2f: 0x4000, + 0xc30: 0x4000, 0xc31: 0x4000, 0xc32: 0x4000, 0xc33: 0x4000, + // Block 0x31, offset 0xc40 + 0xc40: 0x4000, 0xc41: 0x4000, 0xc42: 0x4000, 0xc43: 0x4000, 0xc44: 0x4000, 0xc45: 0x4000, + 0xc46: 0x4000, 0xc47: 0x4000, 0xc48: 0x4000, 0xc49: 0x4000, 0xc4a: 0x4000, 0xc4b: 0x4000, + 0xc4c: 0x4000, 0xc4d: 0x4000, 0xc4e: 0x4000, 0xc4f: 0x4000, 0xc50: 0x4000, 0xc51: 0x4000, + 0xc52: 0x4000, 0xc53: 0x4000, 0xc54: 0x4000, 0xc55: 0x4000, + 0xc70: 0x4000, 0xc71: 0x4000, 0xc72: 0x4000, 0xc73: 0x4000, 0xc74: 0x4000, 0xc75: 0x4000, + 0xc76: 0x4000, 0xc77: 0x4000, 0xc78: 0x4000, 0xc79: 0x4000, 0xc7a: 0x4000, 0xc7b: 0x4000, + // Block 0x32, offset 0xc80 + 0xc80: 0x9012, 0xc81: 0x4013, 0xc82: 0x4014, 0xc83: 0x4000, 0xc84: 0x4000, 0xc85: 0x4000, + 0xc86: 0x4000, 0xc87: 0x4000, 0xc88: 0x4000, 0xc89: 0x4000, 0xc8a: 0x4000, 0xc8b: 0x4000, + 0xc8c: 0x4015, 0xc8d: 0x4015, 0xc8e: 0x4000, 0xc8f: 0x4000, 0xc90: 0x4000, 0xc91: 0x4000, + 0xc92: 0x4000, 0xc93: 0x4000, 0xc94: 0x4000, 0xc95: 0x4000, 0xc96: 0x4000, 0xc97: 0x4000, + 0xc98: 0x4000, 0xc99: 0x4000, 0xc9a: 0x4000, 0xc9b: 0x4000, 0xc9c: 0x4000, 0xc9d: 0x4000, + 0xc9e: 0x4000, 0xc9f: 0x4000, 0xca0: 0x4000, 0xca1: 0x4000, 0xca2: 0x4000, 0xca3: 0x4000, + 0xca4: 0x4000, 0xca5: 0x4000, 0xca6: 0x4000, 0xca7: 0x4000, 0xca8: 0x4000, 0xca9: 0x4000, + 0xcaa: 0x4000, 0xcab: 0x4000, 0xcac: 0x4000, 0xcad: 0x4000, 0xcae: 0x4000, 0xcaf: 0x4000, + 0xcb0: 0x4000, 0xcb1: 0x4000, 0xcb2: 0x4000, 0xcb3: 0x4000, 0xcb4: 0x4000, 0xcb5: 0x4000, + 0xcb6: 0x4000, 0xcb7: 0x4000, 0xcb8: 0x4000, 0xcb9: 0x4000, 0xcba: 0x4000, 0xcbb: 0x4000, + 0xcbc: 0x4000, 0xcbd: 0x4000, 0xcbe: 0x4000, + // Block 0x33, offset 0xcc0 + 0xcc1: 0x4000, 0xcc2: 0x4000, 0xcc3: 0x4000, 0xcc4: 0x4000, 0xcc5: 0x4000, + 0xcc6: 0x4000, 0xcc7: 0x4000, 0xcc8: 0x4000, 0xcc9: 0x4000, 0xcca: 0x4000, 0xccb: 0x4000, + 0xccc: 0x4000, 0xccd: 0x4000, 0xcce: 0x4000, 0xccf: 0x4000, 0xcd0: 0x4000, 0xcd1: 0x4000, + 0xcd2: 0x4000, 0xcd3: 0x4000, 0xcd4: 0x4000, 0xcd5: 0x4000, 0xcd6: 0x4000, 0xcd7: 0x4000, + 0xcd8: 0x4000, 0xcd9: 0x4000, 0xcda: 0x4000, 0xcdb: 0x4000, 0xcdc: 0x4000, 0xcdd: 0x4000, + 0xcde: 0x4000, 0xcdf: 0x4000, 0xce0: 0x4000, 0xce1: 0x4000, 0xce2: 0x4000, 0xce3: 0x4000, + 0xce4: 0x4000, 0xce5: 0x4000, 0xce6: 0x4000, 0xce7: 0x4000, 0xce8: 0x4000, 0xce9: 0x4000, + 0xcea: 0x4000, 0xceb: 0x4000, 0xcec: 0x4000, 0xced: 0x4000, 0xcee: 0x4000, 0xcef: 0x4000, + 0xcf0: 0x4000, 0xcf1: 0x4000, 0xcf2: 0x4000, 0xcf3: 0x4000, 0xcf4: 0x4000, 0xcf5: 0x4000, + 0xcf6: 0x4000, 0xcf7: 0x4000, 0xcf8: 0x4000, 0xcf9: 0x4000, 0xcfa: 0x4000, 0xcfb: 0x4000, + 0xcfc: 0x4000, 0xcfd: 0x4000, 0xcfe: 0x4000, 0xcff: 0x4000, + // Block 0x34, offset 0xd00 + 0xd00: 0x4000, 0xd01: 0x4000, 0xd02: 0x4000, 0xd03: 0x4000, 0xd04: 0x4000, 0xd05: 0x4000, + 0xd06: 0x4000, 0xd07: 0x4000, 0xd08: 0x4000, 0xd09: 0x4000, 0xd0a: 0x4000, 0xd0b: 0x4000, + 0xd0c: 0x4000, 0xd0d: 0x4000, 0xd0e: 0x4000, 0xd0f: 0x4000, 0xd10: 0x4000, 0xd11: 0x4000, + 0xd12: 0x4000, 0xd13: 0x4000, 0xd14: 0x4000, 0xd15: 0x4000, 0xd16: 0x4000, + 0xd19: 0x4016, 0xd1a: 0x4017, 0xd1b: 0x4000, 0xd1c: 0x4000, 0xd1d: 0x4000, + 0xd1e: 0x4000, 0xd1f: 0x4000, 0xd20: 0x4000, 0xd21: 0x4018, 0xd22: 0x4019, 0xd23: 0x401a, + 0xd24: 0x401b, 0xd25: 0x401c, 0xd26: 0x401d, 0xd27: 0x401e, 0xd28: 0x401f, 0xd29: 0x4020, + 0xd2a: 0x4021, 0xd2b: 0x4022, 0xd2c: 0x4000, 0xd2d: 0x4010, 0xd2e: 0x4000, 0xd2f: 0x4023, + 0xd30: 0x4000, 0xd31: 0x4024, 0xd32: 0x4000, 0xd33: 0x4025, 0xd34: 0x4000, 0xd35: 0x4026, + 0xd36: 0x4000, 0xd37: 0x401a, 0xd38: 0x4000, 0xd39: 0x4027, 0xd3a: 0x4000, 0xd3b: 0x4028, + 0xd3c: 0x4000, 0xd3d: 0x4020, 0xd3e: 0x4000, 0xd3f: 0x4029, + // Block 0x35, offset 0xd40 + 0xd40: 0x4000, 0xd41: 0x402a, 0xd42: 0x4000, 0xd43: 0x402b, 0xd44: 0x402c, 0xd45: 0x4000, + 0xd46: 0x4017, 0xd47: 0x4000, 0xd48: 0x402d, 0xd49: 0x4000, 0xd4a: 0x402e, 0xd4b: 0x402f, + 0xd4c: 0x4030, 0xd4d: 0x4017, 0xd4e: 0x4016, 0xd4f: 0x4017, 0xd50: 0x4000, 0xd51: 0x4000, + 0xd52: 0x4031, 0xd53: 0x4000, 0xd54: 0x4000, 0xd55: 0x4031, 0xd56: 0x4000, 0xd57: 0x4000, + 0xd58: 0x4032, 0xd59: 0x4000, 0xd5a: 0x4000, 0xd5b: 0x4032, 0xd5c: 0x4000, 0xd5d: 0x4000, + 0xd5e: 0x4033, 0xd5f: 0x402e, 0xd60: 0x4034, 0xd61: 0x4035, 0xd62: 0x4034, 0xd63: 0x4036, + 0xd64: 0x4037, 0xd65: 0x4024, 0xd66: 0x4035, 0xd67: 0x4025, 0xd68: 0x4038, 0xd69: 0x4038, + 0xd6a: 0x4039, 0xd6b: 0x4039, 0xd6c: 0x403a, 0xd6d: 0x403a, 0xd6e: 0x4000, 0xd6f: 0x4035, + 0xd70: 0x4000, 0xd71: 0x4000, 0xd72: 0x403b, 0xd73: 0x403c, 0xd74: 0x4000, 0xd75: 0x4000, + 0xd76: 0x4000, 0xd77: 0x4000, 0xd78: 0x4000, 0xd79: 0x4000, 0xd7a: 0x4000, 0xd7b: 0x403d, + 0xd7c: 0x401c, 0xd7d: 0x4000, 0xd7e: 0x4000, 0xd7f: 0x4000, + // Block 0x36, offset 0xd80 + 0xd85: 0x4000, + 0xd86: 0x4000, 0xd87: 0x4000, 0xd88: 0x4000, 0xd89: 0x4000, 0xd8a: 0x4000, 0xd8b: 0x4000, + 0xd8c: 0x4000, 0xd8d: 0x4000, 0xd8e: 0x4000, 0xd8f: 0x4000, 0xd90: 0x4000, 0xd91: 0x4000, + 0xd92: 0x4000, 0xd93: 0x4000, 0xd94: 0x4000, 0xd95: 0x4000, 0xd96: 0x4000, 0xd97: 0x4000, + 0xd98: 0x4000, 0xd99: 0x4000, 0xd9a: 0x4000, 0xd9b: 0x4000, 0xd9c: 0x4000, 0xd9d: 0x4000, + 0xd9e: 0x4000, 0xd9f: 0x4000, 0xda0: 0x4000, 0xda1: 0x4000, 0xda2: 0x4000, 0xda3: 0x4000, + 0xda4: 0x4000, 0xda5: 0x4000, 0xda6: 0x4000, 0xda7: 0x4000, 0xda8: 0x4000, 0xda9: 0x4000, + 0xdaa: 0x4000, 0xdab: 0x4000, 0xdac: 0x4000, 0xdad: 0x4000, 0xdae: 0x4000, + 0xdb1: 0x403e, 0xdb2: 0x403e, 0xdb3: 0x403e, 0xdb4: 0x403e, 0xdb5: 0x403e, + 0xdb6: 0x403e, 0xdb7: 0x403e, 0xdb8: 0x403e, 0xdb9: 0x403e, 0xdba: 0x403e, 0xdbb: 0x403e, + 0xdbc: 0x403e, 0xdbd: 0x403e, 0xdbe: 0x403e, 0xdbf: 0x403e, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x4037, 0xdc1: 0x4037, 0xdc2: 0x4037, 0xdc3: 0x4037, 0xdc4: 0x4037, 0xdc5: 0x4037, + 0xdc6: 0x4037, 0xdc7: 0x4037, 0xdc8: 0x4037, 0xdc9: 0x4037, 0xdca: 0x4037, 0xdcb: 0x4037, + 0xdcc: 0x4037, 0xdcd: 0x4037, 0xdce: 0x4037, 0xdcf: 0x400e, 0xdd0: 0x403f, 0xdd1: 0x4040, + 0xdd2: 0x4041, 0xdd3: 0x4040, 0xdd4: 0x403f, 0xdd5: 0x4042, 0xdd6: 0x4043, 0xdd7: 0x4044, + 0xdd8: 0x4040, 0xdd9: 0x4041, 0xdda: 0x4040, 0xddb: 0x4045, 0xddc: 0x4009, 0xddd: 0x4045, + 0xdde: 0x4046, 0xddf: 0x4045, 0xde0: 0x4047, 0xde1: 0x400b, 0xde2: 0x400a, 0xde3: 0x400c, + 0xde4: 0x4048, 0xde5: 0x4000, 0xde6: 0x4000, 0xde7: 0x4000, 0xde8: 0x4000, 0xde9: 0x4000, + 0xdea: 0x4000, 0xdeb: 0x4000, 0xdec: 0x4000, 0xded: 0x4000, 0xdee: 0x4000, 0xdef: 0x4000, + 0xdf0: 0x4000, 0xdf1: 0x4000, 0xdf2: 0x4000, 0xdf3: 0x4000, 0xdf4: 0x4000, 0xdf5: 0x4000, + 0xdf6: 0x4000, 0xdf7: 0x4000, 0xdf8: 0x4000, 0xdf9: 0x4000, 0xdfa: 0x4000, 0xdfb: 0x4000, + 0xdfc: 0x4000, 0xdfd: 0x4000, 0xdfe: 0x4000, 0xdff: 0x4000, + // Block 0x38, offset 0xe00 + 0xe00: 0x4000, 0xe01: 0x4000, 0xe02: 0x4000, 0xe03: 0x4000, 0xe04: 0x4000, 0xe05: 0x4000, + 0xe06: 0x4000, 0xe07: 0x4000, 0xe08: 0x4000, 0xe09: 0x4000, 0xe0a: 0x4000, 0xe0b: 0x4000, + 0xe0c: 0x4000, 0xe0d: 0x4000, 0xe0e: 0x4000, 0xe10: 0x4000, 0xe11: 0x4000, + 0xe12: 0x4000, 0xe13: 0x4000, 0xe14: 0x4000, 0xe15: 0x4000, 0xe16: 0x4000, 0xe17: 0x4000, + 0xe18: 0x4000, 0xe19: 0x4000, 0xe1a: 0x4000, 0xe1b: 0x4000, 0xe1c: 0x4000, 0xe1d: 0x4000, + 0xe1e: 0x4000, 0xe1f: 0x4000, 0xe20: 0x4000, 0xe21: 0x4000, 0xe22: 0x4000, 0xe23: 0x4000, + 0xe24: 0x4000, 0xe25: 0x4000, 0xe26: 0x4000, 0xe27: 0x4000, 0xe28: 0x4000, 0xe29: 0x4000, + 0xe2a: 0x4000, 0xe2b: 0x4000, 0xe2c: 0x4000, 0xe2d: 0x4000, 0xe2e: 0x4000, 0xe2f: 0x4000, + 0xe30: 0x4000, 0xe31: 0x4000, 0xe32: 0x4000, 0xe33: 0x4000, 0xe34: 0x4000, 0xe35: 0x4000, + 0xe36: 0x4000, 0xe37: 0x4000, 0xe38: 0x4000, 0xe39: 0x4000, 0xe3a: 0x4000, + // Block 0x39, offset 0xe40 + 0xe40: 0x4000, 0xe41: 0x4000, 0xe42: 0x4000, 0xe43: 0x4000, 0xe44: 0x4000, 0xe45: 0x4000, + 0xe46: 0x4000, 0xe47: 0x4000, 0xe48: 0x4000, 0xe49: 0x4000, 0xe4a: 0x4000, 0xe4b: 0x4000, + 0xe4c: 0x4000, 0xe4d: 0x4000, 0xe4e: 0x4000, 0xe4f: 0x4000, 0xe50: 0x4000, 0xe51: 0x4000, + 0xe52: 0x4000, 0xe53: 0x4000, 0xe54: 0x4000, 0xe55: 0x4000, 0xe56: 0x4000, 0xe57: 0x4000, + 0xe58: 0x4000, 0xe59: 0x4000, 0xe5a: 0x4000, 0xe5b: 0x4000, 0xe5c: 0x4000, 0xe5d: 0x4000, + 0xe5e: 0x4000, 0xe5f: 0x4000, 0xe60: 0x4000, 0xe61: 0x4000, 0xe62: 0x4000, 0xe63: 0x4000, + 0xe70: 0x4000, 0xe71: 0x4000, 0xe72: 0x4000, 0xe73: 0x4000, 0xe74: 0x4000, 0xe75: 0x4000, + 0xe76: 0x4000, 0xe77: 0x4000, 0xe78: 0x4000, 0xe79: 0x4000, 0xe7a: 0x4000, 0xe7b: 0x4000, + 0xe7c: 0x4000, 0xe7d: 0x4000, 0xe7e: 0x4000, 0xe7f: 0x4000, + // Block 0x3a, offset 0xe80 + 0xe80: 0x4000, 0xe81: 0x4000, 0xe82: 0x4000, 0xe83: 0x4000, 0xe84: 0x4000, 0xe85: 0x4000, + 0xe86: 0x4000, 0xe87: 0x4000, 0xe88: 0x4000, 0xe89: 0x4000, 0xe8a: 0x4000, 0xe8b: 0x4000, + 0xe8c: 0x4000, 0xe8d: 0x4000, 0xe8e: 0x4000, 0xe8f: 0x4000, 0xe90: 0x4000, 0xe91: 0x4000, + 0xe92: 0x4000, 0xe93: 0x4000, 0xe94: 0x4000, 0xe95: 0x4000, 0xe96: 0x4000, 0xe97: 0x4000, + 0xe98: 0x4000, 0xe99: 0x4000, 0xe9a: 0x4000, 0xe9b: 0x4000, 0xe9c: 0x4000, 0xe9d: 0x4000, + 0xe9e: 0x4000, 0xea0: 0x4000, 0xea1: 0x4000, 0xea2: 0x4000, 0xea3: 0x4000, + 0xea4: 0x4000, 0xea5: 0x4000, 0xea6: 0x4000, 0xea7: 0x4000, 0xea8: 0x4000, 0xea9: 0x4000, + 0xeaa: 0x4000, 0xeab: 0x4000, 0xeac: 0x4000, 0xead: 0x4000, 0xeae: 0x4000, 0xeaf: 0x4000, + 0xeb0: 0x4000, 0xeb1: 0x4000, 0xeb2: 0x4000, 0xeb3: 0x4000, 0xeb4: 0x4000, 0xeb5: 0x4000, + 0xeb6: 0x4000, 0xeb7: 0x4000, 0xeb8: 0x4000, 0xeb9: 0x4000, 0xeba: 0x4000, 0xebb: 0x4000, + 0xebc: 0x4000, 0xebd: 0x4000, 0xebe: 0x4000, 0xebf: 0x4000, + // Block 0x3b, offset 0xec0 + 0xec0: 0x4000, 0xec1: 0x4000, 0xec2: 0x4000, 0xec3: 0x4000, 0xec4: 0x4000, 0xec5: 0x4000, + 0xec6: 0x4000, 0xec7: 0x4000, 0xec8: 0x2000, 0xec9: 0x2000, 0xeca: 0x2000, 0xecb: 0x2000, + 0xecc: 0x2000, 0xecd: 0x2000, 0xece: 0x2000, 0xecf: 0x2000, 0xed0: 0x4000, 0xed1: 0x4000, + 0xed2: 0x4000, 0xed3: 0x4000, 0xed4: 0x4000, 0xed5: 0x4000, 0xed6: 0x4000, 0xed7: 0x4000, + 0xed8: 0x4000, 0xed9: 0x4000, 0xeda: 0x4000, 0xedb: 0x4000, 0xedc: 0x4000, 0xedd: 0x4000, + 0xede: 0x4000, 0xedf: 0x4000, 0xee0: 0x4000, 0xee1: 0x4000, 0xee2: 0x4000, 0xee3: 0x4000, + 0xee4: 0x4000, 0xee5: 0x4000, 0xee6: 0x4000, 0xee7: 0x4000, 0xee8: 0x4000, 0xee9: 0x4000, + 0xeea: 0x4000, 0xeeb: 0x4000, 0xeec: 0x4000, 0xeed: 0x4000, 0xeee: 0x4000, 0xeef: 0x4000, + 0xef0: 0x4000, 0xef1: 0x4000, 0xef2: 0x4000, 0xef3: 0x4000, 0xef4: 0x4000, 0xef5: 0x4000, + 0xef6: 0x4000, 0xef7: 0x4000, 0xef8: 0x4000, 0xef9: 0x4000, 0xefa: 0x4000, 0xefb: 0x4000, + 0xefc: 0x4000, 0xefd: 0x4000, 0xefe: 0x4000, 0xeff: 0x4000, + // Block 0x3c, offset 0xf00 + 0xf00: 0x4000, 0xf01: 0x4000, 0xf02: 0x4000, 0xf03: 0x4000, 0xf04: 0x4000, 0xf05: 0x4000, + 0xf06: 0x4000, 0xf07: 0x4000, 0xf08: 0x4000, 0xf09: 0x4000, 0xf0a: 0x4000, 0xf0b: 0x4000, + 0xf0c: 0x4000, 0xf0d: 0x4000, 0xf0e: 0x4000, 0xf0f: 0x4000, 0xf10: 0x4000, 0xf11: 0x4000, + 0xf12: 0x4000, 0xf13: 0x4000, 0xf14: 0x4000, 0xf15: 0x4000, 0xf16: 0x4000, 0xf17: 0x4000, + 0xf18: 0x4000, 0xf19: 0x4000, 0xf1a: 0x4000, 0xf1b: 0x4000, 0xf1c: 0x4000, 0xf1d: 0x4000, + 0xf1e: 0x4000, 0xf1f: 0x4000, 0xf20: 0x4000, 0xf21: 0x4000, 0xf22: 0x4000, 0xf23: 0x4000, + 0xf24: 0x4000, 0xf25: 0x4000, 0xf26: 0x4000, 0xf27: 0x4000, 0xf28: 0x4000, 0xf29: 0x4000, + 0xf2a: 0x4000, 0xf2b: 0x4000, 0xf2c: 0x4000, 0xf2d: 0x4000, 0xf2e: 0x4000, 0xf2f: 0x4000, + 0xf30: 0x4000, 0xf31: 0x4000, 0xf32: 0x4000, 0xf33: 0x4000, 0xf34: 0x4000, 0xf35: 0x4000, + 0xf36: 0x4000, 0xf37: 0x4000, 0xf38: 0x4000, 0xf39: 0x4000, 0xf3a: 0x4000, 0xf3b: 0x4000, + 0xf3c: 0x4000, 0xf3d: 0x4000, 0xf3e: 0x4000, + // Block 0x3d, offset 0xf40 + 0xf40: 0x4000, 0xf41: 0x4000, 0xf42: 0x4000, 0xf43: 0x4000, 0xf44: 0x4000, 0xf45: 0x4000, + 0xf46: 0x4000, 0xf47: 0x4000, 0xf48: 0x4000, 0xf49: 0x4000, 0xf4a: 0x4000, 0xf4b: 0x4000, + 0xf4c: 0x4000, 0xf50: 0x4000, 0xf51: 0x4000, + 0xf52: 0x4000, 0xf53: 0x4000, 0xf54: 0x4000, 0xf55: 0x4000, 0xf56: 0x4000, 0xf57: 0x4000, + 0xf58: 0x4000, 0xf59: 0x4000, 0xf5a: 0x4000, 0xf5b: 0x4000, 0xf5c: 0x4000, 0xf5d: 0x4000, + 0xf5e: 0x4000, 0xf5f: 0x4000, 0xf60: 0x4000, 0xf61: 0x4000, 0xf62: 0x4000, 0xf63: 0x4000, + 0xf64: 0x4000, 0xf65: 0x4000, 0xf66: 0x4000, 0xf67: 0x4000, 0xf68: 0x4000, 0xf69: 0x4000, + 0xf6a: 0x4000, 0xf6b: 0x4000, 0xf6c: 0x4000, 0xf6d: 0x4000, 0xf6e: 0x4000, 0xf6f: 0x4000, + 0xf70: 0x4000, 0xf71: 0x4000, 0xf72: 0x4000, 0xf73: 0x4000, 0xf74: 0x4000, 0xf75: 0x4000, + 0xf76: 0x4000, 0xf77: 0x4000, 0xf78: 0x4000, 0xf79: 0x4000, 0xf7a: 0x4000, 0xf7b: 0x4000, + 0xf7c: 0x4000, 0xf7d: 0x4000, 0xf7e: 0x4000, 0xf7f: 0x4000, + // Block 0x3e, offset 0xf80 + 0xf80: 0x4000, 0xf81: 0x4000, 0xf82: 0x4000, 0xf83: 0x4000, 0xf84: 0x4000, 0xf85: 0x4000, + 0xf86: 0x4000, + // Block 0x3f, offset 0xfc0 + 0xfe0: 0x4000, 0xfe1: 0x4000, 0xfe2: 0x4000, 0xfe3: 0x4000, + 0xfe4: 0x4000, 0xfe5: 0x4000, 0xfe6: 0x4000, 0xfe7: 0x4000, 0xfe8: 0x4000, 0xfe9: 0x4000, + 0xfea: 0x4000, 0xfeb: 0x4000, 0xfec: 0x4000, 0xfed: 0x4000, 0xfee: 0x4000, 0xfef: 0x4000, + 0xff0: 0x4000, 0xff1: 0x4000, 0xff2: 0x4000, 0xff3: 0x4000, 0xff4: 0x4000, 0xff5: 0x4000, + 0xff6: 0x4000, 0xff7: 0x4000, 0xff8: 0x4000, 0xff9: 0x4000, 0xffa: 0x4000, 0xffb: 0x4000, + 0xffc: 0x4000, + // Block 0x40, offset 0x1000 + 0x1000: 0x4000, 0x1001: 0x4000, 0x1002: 0x4000, 0x1003: 0x4000, 0x1004: 0x4000, 0x1005: 0x4000, + 0x1006: 0x4000, 0x1007: 0x4000, 0x1008: 0x4000, 0x1009: 0x4000, 0x100a: 0x4000, 0x100b: 0x4000, + 0x100c: 0x4000, 0x100d: 0x4000, 0x100e: 0x4000, 0x100f: 0x4000, 0x1010: 0x4000, 0x1011: 0x4000, + 0x1012: 0x4000, 0x1013: 0x4000, 0x1014: 0x4000, 0x1015: 0x4000, 0x1016: 0x4000, 0x1017: 0x4000, + 0x1018: 0x4000, 0x1019: 0x4000, 0x101a: 0x4000, 0x101b: 0x4000, 0x101c: 0x4000, 0x101d: 0x4000, + 0x101e: 0x4000, 0x101f: 0x4000, 0x1020: 0x4000, 0x1021: 0x4000, 0x1022: 0x4000, 0x1023: 0x4000, + // Block 0x41, offset 0x1040 + 0x1040: 0x2000, 0x1041: 0x2000, 0x1042: 0x2000, 0x1043: 0x2000, 0x1044: 0x2000, 0x1045: 0x2000, + 0x1046: 0x2000, 0x1047: 0x2000, 0x1048: 0x2000, 0x1049: 0x2000, 0x104a: 0x2000, 0x104b: 0x2000, + 0x104c: 0x2000, 0x104d: 0x2000, 0x104e: 0x2000, 0x104f: 0x2000, 0x1050: 0x4000, 0x1051: 0x4000, + 0x1052: 0x4000, 0x1053: 0x4000, 0x1054: 0x4000, 0x1055: 0x4000, 0x1056: 0x4000, 0x1057: 0x4000, + 0x1058: 0x4000, 0x1059: 0x4000, + 0x1070: 0x4000, 0x1071: 0x4000, 0x1072: 0x4000, 0x1073: 0x4000, 0x1074: 0x4000, 0x1075: 0x4000, + 0x1076: 0x4000, 0x1077: 0x4000, 0x1078: 0x4000, 0x1079: 0x4000, 0x107a: 0x4000, 0x107b: 0x4000, + 0x107c: 0x4000, 0x107d: 0x4000, 0x107e: 0x4000, 0x107f: 0x4000, + // Block 0x42, offset 0x1080 + 0x1080: 0x4000, 0x1081: 0x4000, 0x1082: 0x4000, 0x1083: 0x4000, 0x1084: 0x4000, 0x1085: 0x4000, + 0x1086: 0x4000, 0x1087: 0x4000, 0x1088: 0x4000, 0x1089: 0x4000, 0x108a: 0x4000, 0x108b: 0x4000, + 0x108c: 0x4000, 0x108d: 0x4000, 0x108e: 0x4000, 0x108f: 0x4000, 0x1090: 0x4000, 0x1091: 0x4000, + 0x1092: 0x4000, 0x1094: 0x4000, 0x1095: 0x4000, 0x1096: 0x4000, 0x1097: 0x4000, + 0x1098: 0x4000, 0x1099: 0x4000, 0x109a: 0x4000, 0x109b: 0x4000, 0x109c: 0x4000, 0x109d: 0x4000, + 0x109e: 0x4000, 0x109f: 0x4000, 0x10a0: 0x4000, 0x10a1: 0x4000, 0x10a2: 0x4000, 0x10a3: 0x4000, + 0x10a4: 0x4000, 0x10a5: 0x4000, 0x10a6: 0x4000, 0x10a8: 0x4000, 0x10a9: 0x4000, + 0x10aa: 0x4000, 0x10ab: 0x4000, + // Block 0x43, offset 0x10c0 + 0x10c1: 0x9012, 0x10c2: 0x9012, 0x10c3: 0x9012, 0x10c4: 0x9012, 0x10c5: 0x9012, + 0x10c6: 0x9012, 0x10c7: 0x9012, 0x10c8: 0x9012, 0x10c9: 0x9012, 0x10ca: 0x9012, 0x10cb: 0x9012, + 0x10cc: 0x9012, 0x10cd: 0x9012, 0x10ce: 0x9012, 0x10cf: 0x9012, 0x10d0: 0x9012, 0x10d1: 0x9012, + 0x10d2: 0x9012, 0x10d3: 0x9012, 0x10d4: 0x9012, 0x10d5: 0x9012, 0x10d6: 0x9012, 0x10d7: 0x9012, + 0x10d8: 0x9012, 0x10d9: 0x9012, 0x10da: 0x9012, 0x10db: 0x9012, 0x10dc: 0x9012, 0x10dd: 0x9012, + 0x10de: 0x9012, 0x10df: 0x9012, 0x10e0: 0x9049, 0x10e1: 0x9049, 0x10e2: 0x9049, 0x10e3: 0x9049, + 0x10e4: 0x9049, 0x10e5: 0x9049, 0x10e6: 0x9049, 0x10e7: 0x9049, 0x10e8: 0x9049, 0x10e9: 0x9049, + 0x10ea: 0x9049, 0x10eb: 0x9049, 0x10ec: 0x9049, 0x10ed: 0x9049, 0x10ee: 0x9049, 0x10ef: 0x9049, + 0x10f0: 0x9049, 0x10f1: 0x9049, 0x10f2: 0x9049, 0x10f3: 0x9049, 0x10f4: 0x9049, 0x10f5: 0x9049, + 0x10f6: 0x9049, 0x10f7: 0x9049, 0x10f8: 0x9049, 0x10f9: 0x9049, 0x10fa: 0x9049, 0x10fb: 0x9049, + 0x10fc: 0x9049, 0x10fd: 0x9049, 0x10fe: 0x9049, 0x10ff: 0x9049, + // Block 0x44, offset 0x1100 + 0x1100: 0x9049, 0x1101: 0x9049, 0x1102: 0x9049, 0x1103: 0x9049, 0x1104: 0x9049, 0x1105: 0x9049, + 0x1106: 0x9049, 0x1107: 0x9049, 0x1108: 0x9049, 0x1109: 0x9049, 0x110a: 0x9049, 0x110b: 0x9049, + 0x110c: 0x9049, 0x110d: 0x9049, 0x110e: 0x9049, 0x110f: 0x9049, 0x1110: 0x9049, 0x1111: 0x9049, + 0x1112: 0x9049, 0x1113: 0x9049, 0x1114: 0x9049, 0x1115: 0x9049, 0x1116: 0x9049, 0x1117: 0x9049, + 0x1118: 0x9049, 0x1119: 0x9049, 0x111a: 0x9049, 0x111b: 0x9049, 0x111c: 0x9049, 0x111d: 0x9049, + 0x111e: 0x9049, 0x111f: 0x904a, 0x1120: 0x904b, 0x1121: 0xb04c, 0x1122: 0xb04d, 0x1123: 0xb04d, + 0x1124: 0xb04e, 0x1125: 0xb04f, 0x1126: 0xb050, 0x1127: 0xb051, 0x1128: 0xb052, 0x1129: 0xb053, + 0x112a: 0xb054, 0x112b: 0xb055, 0x112c: 0xb056, 0x112d: 0xb057, 0x112e: 0xb058, 0x112f: 0xb059, + 0x1130: 0xb05a, 0x1131: 0xb05b, 0x1132: 0xb05c, 0x1133: 0xb05d, 0x1134: 0xb05e, 0x1135: 0xb05f, + 0x1136: 0xb060, 0x1137: 0xb061, 0x1138: 0xb062, 0x1139: 0xb063, 0x113a: 0xb064, 0x113b: 0xb065, + 0x113c: 0xb052, 0x113d: 0xb066, 0x113e: 0xb067, 0x113f: 0xb055, + // Block 0x45, offset 0x1140 + 0x1140: 0xb068, 0x1141: 0xb069, 0x1142: 0xb06a, 0x1143: 0xb06b, 0x1144: 0xb05a, 0x1145: 0xb056, + 0x1146: 0xb06c, 0x1147: 0xb06d, 0x1148: 0xb06b, 0x1149: 0xb06e, 0x114a: 0xb06b, 0x114b: 0xb06f, + 0x114c: 0xb06f, 0x114d: 0xb070, 0x114e: 0xb070, 0x114f: 0xb071, 0x1150: 0xb056, 0x1151: 0xb072, + 0x1152: 0xb073, 0x1153: 0xb072, 0x1154: 0xb074, 0x1155: 0xb073, 0x1156: 0xb075, 0x1157: 0xb075, + 0x1158: 0xb076, 0x1159: 0xb076, 0x115a: 0xb077, 0x115b: 0xb077, 0x115c: 0xb073, 0x115d: 0xb078, + 0x115e: 0xb079, 0x115f: 0xb067, 0x1160: 0xb07a, 0x1161: 0xb07b, 0x1162: 0xb07b, 0x1163: 0xb07b, + 0x1164: 0xb07b, 0x1165: 0xb07b, 0x1166: 0xb07b, 0x1167: 0xb07b, 0x1168: 0xb07b, 0x1169: 0xb07b, + 0x116a: 0xb07b, 0x116b: 0xb07b, 0x116c: 0xb07b, 0x116d: 0xb07b, 0x116e: 0xb07b, 0x116f: 0xb07b, + 0x1170: 0xb07c, 0x1171: 0xb07c, 0x1172: 0xb07c, 0x1173: 0xb07c, 0x1174: 0xb07c, 0x1175: 0xb07c, + 0x1176: 0xb07c, 0x1177: 0xb07c, 0x1178: 0xb07c, 0x1179: 0xb07c, 0x117a: 0xb07c, 0x117b: 0xb07c, + 0x117c: 0xb07c, 0x117d: 0xb07c, 0x117e: 0xb07c, + // Block 0x46, offset 0x1180 + 0x1182: 0xb07d, 0x1183: 0xb07e, 0x1184: 0xb07f, 0x1185: 0xb080, + 0x1186: 0xb07f, 0x1187: 0xb07e, 0x118a: 0xb081, 0x118b: 0xb082, + 0x118c: 0xb083, 0x118d: 0xb07f, 0x118e: 0xb080, 0x118f: 0xb07f, + 0x1192: 0xb084, 0x1193: 0xb085, 0x1194: 0xb084, 0x1195: 0xb086, 0x1196: 0xb084, 0x1197: 0xb087, + 0x119a: 0xb088, 0x119b: 0xb089, 0x119c: 0xb08a, + 0x11a0: 0x908b, 0x11a1: 0x908b, 0x11a2: 0x908c, 0x11a3: 0x908d, + 0x11a4: 0x908b, 0x11a5: 0x908e, 0x11a6: 0x908f, 0x11a8: 0xb090, 0x11a9: 0xb091, + 0x11aa: 0xb092, 0x11ab: 0xb091, 0x11ac: 0xb093, 0x11ad: 0xb094, 0x11ae: 0xb095, + 0x11bd: 0x2000, + // Block 0x47, offset 0x11c0 + 0x11e0: 0x4000, 0x11e1: 0x4000, + // Block 0x48, offset 0x1200 + 0x1200: 0x4000, 0x1201: 0x4000, 0x1202: 0x4000, 0x1203: 0x4000, 0x1204: 0x4000, 0x1205: 0x4000, + 0x1206: 0x4000, 0x1207: 0x4000, 0x1208: 0x4000, 0x1209: 0x4000, 0x120a: 0x4000, 0x120b: 0x4000, + 0x120c: 0x4000, 0x120d: 0x4000, 0x120e: 0x4000, 0x120f: 0x4000, 0x1210: 0x4000, 0x1211: 0x4000, + 0x1212: 0x4000, 0x1213: 0x4000, 0x1214: 0x4000, 0x1215: 0x4000, 0x1216: 0x4000, 0x1217: 0x4000, + 0x1218: 0x4000, 0x1219: 0x4000, 0x121a: 0x4000, 0x121b: 0x4000, 0x121c: 0x4000, 0x121d: 0x4000, + 0x121e: 0x4000, 0x121f: 0x4000, 0x1220: 0x4000, 0x1221: 0x4000, 0x1222: 0x4000, 0x1223: 0x4000, + 0x1224: 0x4000, 0x1225: 0x4000, 0x1226: 0x4000, 0x1227: 0x4000, 0x1228: 0x4000, 0x1229: 0x4000, + 0x122a: 0x4000, 0x122b: 0x4000, 0x122c: 0x4000, + // Block 0x49, offset 0x1240 + 0x1240: 0x4000, 0x1241: 0x4000, 0x1242: 0x4000, 0x1243: 0x4000, 0x1244: 0x4000, 0x1245: 0x4000, + 0x1246: 0x4000, 0x1247: 0x4000, 0x1248: 0x4000, 0x1249: 0x4000, 0x124a: 0x4000, 0x124b: 0x4000, + 0x124c: 0x4000, 0x124d: 0x4000, 0x124e: 0x4000, 0x124f: 0x4000, 0x1250: 0x4000, 0x1251: 0x4000, + 0x1252: 0x4000, 0x1253: 0x4000, 0x1254: 0x4000, 0x1255: 0x4000, 0x1256: 0x4000, 0x1257: 0x4000, + 0x1258: 0x4000, 0x1259: 0x4000, 0x125a: 0x4000, 0x125b: 0x4000, 0x125c: 0x4000, 0x125d: 0x4000, + 0x125e: 0x4000, 0x125f: 0x4000, 0x1260: 0x4000, 0x1261: 0x4000, 0x1262: 0x4000, 0x1263: 0x4000, + 0x1264: 0x4000, 0x1265: 0x4000, 0x1266: 0x4000, 0x1267: 0x4000, 0x1268: 0x4000, 0x1269: 0x4000, + 0x126a: 0x4000, 0x126b: 0x4000, 0x126c: 0x4000, 0x126d: 0x4000, 0x126e: 0x4000, 0x126f: 0x4000, + 0x1270: 0x4000, 0x1271: 0x4000, 0x1272: 0x4000, + // Block 0x4a, offset 0x1280 + 0x1280: 0x4000, 0x1281: 0x4000, 0x1282: 0x4000, 0x1283: 0x4000, 0x1284: 0x4000, 0x1285: 0x4000, + 0x1286: 0x4000, 0x1287: 0x4000, 0x1288: 0x4000, 0x1289: 0x4000, 0x128a: 0x4000, 0x128b: 0x4000, + 0x128c: 0x4000, 0x128d: 0x4000, 0x128e: 0x4000, 0x128f: 0x4000, 0x1290: 0x4000, 0x1291: 0x4000, + 0x1292: 0x4000, 0x1293: 0x4000, 0x1294: 0x4000, 0x1295: 0x4000, 0x1296: 0x4000, 0x1297: 0x4000, + 0x1298: 0x4000, 0x1299: 0x4000, 0x129a: 0x4000, 0x129b: 0x4000, 0x129c: 0x4000, 0x129d: 0x4000, + 0x129e: 0x4000, + // Block 0x4b, offset 0x12c0 + 0x12f0: 0x4000, 0x12f1: 0x4000, 0x12f2: 0x4000, 0x12f3: 0x4000, 0x12f4: 0x4000, 0x12f5: 0x4000, + 0x12f6: 0x4000, 0x12f7: 0x4000, 0x12f8: 0x4000, 0x12f9: 0x4000, 0x12fa: 0x4000, 0x12fb: 0x4000, + 0x12fc: 0x4000, 0x12fd: 0x4000, 0x12fe: 0x4000, 0x12ff: 0x4000, + // Block 0x4c, offset 0x1300 + 0x1300: 0x4000, 0x1301: 0x4000, 0x1302: 0x4000, 0x1303: 0x4000, 0x1304: 0x4000, 0x1305: 0x4000, + 0x1306: 0x4000, 0x1307: 0x4000, 0x1308: 0x4000, 0x1309: 0x4000, 0x130a: 0x4000, 0x130b: 0x4000, + 0x130c: 0x4000, 0x130d: 0x4000, 0x130e: 0x4000, 0x130f: 0x4000, 0x1310: 0x4000, 0x1311: 0x4000, + 0x1312: 0x4000, 0x1313: 0x4000, 0x1314: 0x4000, 0x1315: 0x4000, 0x1316: 0x4000, 0x1317: 0x4000, + 0x1318: 0x4000, 0x1319: 0x4000, 0x131a: 0x4000, 0x131b: 0x4000, 0x131c: 0x4000, 0x131d: 0x4000, + 0x131e: 0x4000, 0x131f: 0x4000, 0x1320: 0x4000, 0x1321: 0x4000, 0x1322: 0x4000, 0x1323: 0x4000, + 0x1324: 0x4000, 0x1325: 0x4000, 0x1326: 0x4000, 0x1327: 0x4000, 0x1328: 0x4000, 0x1329: 0x4000, + 0x132a: 0x4000, 0x132b: 0x4000, 0x132c: 0x4000, 0x132d: 0x4000, 0x132e: 0x4000, 0x132f: 0x4000, + 0x1330: 0x4000, 0x1331: 0x4000, 0x1332: 0x4000, 0x1333: 0x4000, 0x1334: 0x4000, 0x1335: 0x4000, + 0x1336: 0x4000, 0x1337: 0x4000, 0x1338: 0x4000, 0x1339: 0x4000, 0x133a: 0x4000, 0x133b: 0x4000, + // Block 0x4d, offset 0x1340 + 0x1344: 0x4000, + // Block 0x4e, offset 0x1380 + 0x138f: 0x4000, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x2000, 0x13c1: 0x2000, 0x13c2: 0x2000, 0x13c3: 0x2000, 0x13c4: 0x2000, 0x13c5: 0x2000, + 0x13c6: 0x2000, 0x13c7: 0x2000, 0x13c8: 0x2000, 0x13c9: 0x2000, 0x13ca: 0x2000, + 0x13d0: 0x2000, 0x13d1: 0x2000, + 0x13d2: 0x2000, 0x13d3: 0x2000, 0x13d4: 0x2000, 0x13d5: 0x2000, 0x13d6: 0x2000, 0x13d7: 0x2000, + 0x13d8: 0x2000, 0x13d9: 0x2000, 0x13da: 0x2000, 0x13db: 0x2000, 0x13dc: 0x2000, 0x13dd: 0x2000, + 0x13de: 0x2000, 0x13df: 0x2000, 0x13e0: 0x2000, 0x13e1: 0x2000, 0x13e2: 0x2000, 0x13e3: 0x2000, + 0x13e4: 0x2000, 0x13e5: 0x2000, 0x13e6: 0x2000, 0x13e7: 0x2000, 0x13e8: 0x2000, 0x13e9: 0x2000, + 0x13ea: 0x2000, 0x13eb: 0x2000, 0x13ec: 0x2000, 0x13ed: 0x2000, + 0x13f0: 0x2000, 0x13f1: 0x2000, 0x13f2: 0x2000, 0x13f3: 0x2000, 0x13f4: 0x2000, 0x13f5: 0x2000, + 0x13f6: 0x2000, 0x13f7: 0x2000, 0x13f8: 0x2000, 0x13f9: 0x2000, 0x13fa: 0x2000, 0x13fb: 0x2000, + 0x13fc: 0x2000, 0x13fd: 0x2000, 0x13fe: 0x2000, 0x13ff: 0x2000, + // Block 0x50, offset 0x1400 + 0x1400: 0x2000, 0x1401: 0x2000, 0x1402: 0x2000, 0x1403: 0x2000, 0x1404: 0x2000, 0x1405: 0x2000, + 0x1406: 0x2000, 0x1407: 0x2000, 0x1408: 0x2000, 0x1409: 0x2000, 0x140a: 0x2000, 0x140b: 0x2000, + 0x140c: 0x2000, 0x140d: 0x2000, 0x140e: 0x2000, 0x140f: 0x2000, 0x1410: 0x2000, 0x1411: 0x2000, + 0x1412: 0x2000, 0x1413: 0x2000, 0x1414: 0x2000, 0x1415: 0x2000, 0x1416: 0x2000, 0x1417: 0x2000, + 0x1418: 0x2000, 0x1419: 0x2000, 0x141a: 0x2000, 0x141b: 0x2000, 0x141c: 0x2000, 0x141d: 0x2000, + 0x141e: 0x2000, 0x141f: 0x2000, 0x1420: 0x2000, 0x1421: 0x2000, 0x1422: 0x2000, 0x1423: 0x2000, + 0x1424: 0x2000, 0x1425: 0x2000, 0x1426: 0x2000, 0x1427: 0x2000, 0x1428: 0x2000, 0x1429: 0x2000, + 0x1430: 0x2000, 0x1431: 0x2000, 0x1432: 0x2000, 0x1433: 0x2000, 0x1434: 0x2000, 0x1435: 0x2000, + 0x1436: 0x2000, 0x1437: 0x2000, 0x1438: 0x2000, 0x1439: 0x2000, 0x143a: 0x2000, 0x143b: 0x2000, + 0x143c: 0x2000, 0x143d: 0x2000, 0x143e: 0x2000, 0x143f: 0x2000, + // Block 0x51, offset 0x1440 + 0x1440: 0x2000, 0x1441: 0x2000, 0x1442: 0x2000, 0x1443: 0x2000, 0x1444: 0x2000, 0x1445: 0x2000, + 0x1446: 0x2000, 0x1447: 0x2000, 0x1448: 0x2000, 0x1449: 0x2000, 0x144a: 0x2000, 0x144b: 0x2000, + 0x144c: 0x2000, 0x144d: 0x2000, 0x144e: 0x4000, 0x144f: 0x2000, 0x1450: 0x2000, 0x1451: 0x4000, + 0x1452: 0x4000, 0x1453: 0x4000, 0x1454: 0x4000, 0x1455: 0x4000, 0x1456: 0x4000, 0x1457: 0x4000, + 0x1458: 0x4000, 0x1459: 0x4000, 0x145a: 0x4000, 0x145b: 0x2000, 0x145c: 0x2000, 0x145d: 0x2000, + 0x145e: 0x2000, 0x145f: 0x2000, 0x1460: 0x2000, 0x1461: 0x2000, 0x1462: 0x2000, 0x1463: 0x2000, + 0x1464: 0x2000, 0x1465: 0x2000, 0x1466: 0x2000, 0x1467: 0x2000, 0x1468: 0x2000, 0x1469: 0x2000, + 0x146a: 0x2000, 0x146b: 0x2000, 0x146c: 0x2000, + // Block 0x52, offset 0x1480 + 0x1480: 0x4000, 0x1481: 0x4000, 0x1482: 0x4000, + 0x1490: 0x4000, 0x1491: 0x4000, + 0x1492: 0x4000, 0x1493: 0x4000, 0x1494: 0x4000, 0x1495: 0x4000, 0x1496: 0x4000, 0x1497: 0x4000, + 0x1498: 0x4000, 0x1499: 0x4000, 0x149a: 0x4000, 0x149b: 0x4000, 0x149c: 0x4000, 0x149d: 0x4000, + 0x149e: 0x4000, 0x149f: 0x4000, 0x14a0: 0x4000, 0x14a1: 0x4000, 0x14a2: 0x4000, 0x14a3: 0x4000, + 0x14a4: 0x4000, 0x14a5: 0x4000, 0x14a6: 0x4000, 0x14a7: 0x4000, 0x14a8: 0x4000, 0x14a9: 0x4000, + 0x14aa: 0x4000, 0x14ab: 0x4000, 0x14ac: 0x4000, 0x14ad: 0x4000, 0x14ae: 0x4000, 0x14af: 0x4000, + 0x14b0: 0x4000, 0x14b1: 0x4000, 0x14b2: 0x4000, 0x14b3: 0x4000, 0x14b4: 0x4000, 0x14b5: 0x4000, + 0x14b6: 0x4000, 0x14b7: 0x4000, 0x14b8: 0x4000, 0x14b9: 0x4000, 0x14ba: 0x4000, 0x14bb: 0x4000, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x4000, 0x14c1: 0x4000, 0x14c2: 0x4000, 0x14c3: 0x4000, 0x14c4: 0x4000, 0x14c5: 0x4000, + 0x14c6: 0x4000, 0x14c7: 0x4000, 0x14c8: 0x4000, + 0x14d0: 0x4000, 0x14d1: 0x4000, + 0x14e0: 0x4000, 0x14e1: 0x4000, 0x14e2: 0x4000, 0x14e3: 0x4000, + 0x14e4: 0x4000, 0x14e5: 0x4000, + // Block 0x54, offset 0x1500 + 0x1500: 0x4000, 0x1501: 0x4000, 0x1502: 0x4000, 0x1503: 0x4000, 0x1504: 0x4000, 0x1505: 0x4000, + 0x1506: 0x4000, 0x1507: 0x4000, 0x1508: 0x4000, 0x1509: 0x4000, 0x150a: 0x4000, 0x150b: 0x4000, + 0x150c: 0x4000, 0x150d: 0x4000, 0x150e: 0x4000, 0x150f: 0x4000, 0x1510: 0x4000, 0x1511: 0x4000, + 0x1512: 0x4000, 0x1513: 0x4000, 0x1514: 0x4000, 0x1515: 0x4000, 0x1516: 0x4000, 0x1517: 0x4000, + 0x1518: 0x4000, 0x1519: 0x4000, 0x151a: 0x4000, 0x151b: 0x4000, 0x151c: 0x4000, 0x151d: 0x4000, + 0x151e: 0x4000, 0x151f: 0x4000, 0x1520: 0x4000, + 0x152d: 0x4000, 0x152e: 0x4000, 0x152f: 0x4000, + 0x1530: 0x4000, 0x1531: 0x4000, 0x1532: 0x4000, 0x1533: 0x4000, 0x1534: 0x4000, 0x1535: 0x4000, + 0x1537: 0x4000, 0x1538: 0x4000, 0x1539: 0x4000, 0x153a: 0x4000, 0x153b: 0x4000, + 0x153c: 0x4000, 0x153d: 0x4000, 0x153e: 0x4000, 0x153f: 0x4000, + // Block 0x55, offset 0x1540 + 0x1540: 0x4000, 0x1541: 0x4000, 0x1542: 0x4000, 0x1543: 0x4000, 0x1544: 0x4000, 0x1545: 0x4000, + 0x1546: 0x4000, 0x1547: 0x4000, 0x1548: 0x4000, 0x1549: 0x4000, 0x154a: 0x4000, 0x154b: 0x4000, + 0x154c: 0x4000, 0x154d: 0x4000, 0x154e: 0x4000, 0x154f: 0x4000, 0x1550: 0x4000, 0x1551: 0x4000, + 0x1552: 0x4000, 0x1553: 0x4000, 0x1554: 0x4000, 0x1555: 0x4000, 0x1556: 0x4000, 0x1557: 0x4000, + 0x1558: 0x4000, 0x1559: 0x4000, 0x155a: 0x4000, 0x155b: 0x4000, 0x155c: 0x4000, 0x155d: 0x4000, + 0x155e: 0x4000, 0x155f: 0x4000, 0x1560: 0x4000, 0x1561: 0x4000, 0x1562: 0x4000, 0x1563: 0x4000, + 0x1564: 0x4000, 0x1565: 0x4000, 0x1566: 0x4000, 0x1567: 0x4000, 0x1568: 0x4000, 0x1569: 0x4000, + 0x156a: 0x4000, 0x156b: 0x4000, 0x156c: 0x4000, 0x156d: 0x4000, 0x156e: 0x4000, 0x156f: 0x4000, + 0x1570: 0x4000, 0x1571: 0x4000, 0x1572: 0x4000, 0x1573: 0x4000, 0x1574: 0x4000, 0x1575: 0x4000, + 0x1576: 0x4000, 0x1577: 0x4000, 0x1578: 0x4000, 0x1579: 0x4000, 0x157a: 0x4000, 0x157b: 0x4000, + 0x157c: 0x4000, 0x157e: 0x4000, 0x157f: 0x4000, + // Block 0x56, offset 0x1580 + 0x1580: 0x4000, 0x1581: 0x4000, 0x1582: 0x4000, 0x1583: 0x4000, 0x1584: 0x4000, 0x1585: 0x4000, + 0x1586: 0x4000, 0x1587: 0x4000, 0x1588: 0x4000, 0x1589: 0x4000, 0x158a: 0x4000, 0x158b: 0x4000, + 0x158c: 0x4000, 0x158d: 0x4000, 0x158e: 0x4000, 0x158f: 0x4000, 0x1590: 0x4000, 0x1591: 0x4000, + 0x1592: 0x4000, 0x1593: 0x4000, + 0x15a0: 0x4000, 0x15a1: 0x4000, 0x15a2: 0x4000, 0x15a3: 0x4000, + 0x15a4: 0x4000, 0x15a5: 0x4000, 0x15a6: 0x4000, 0x15a7: 0x4000, 0x15a8: 0x4000, 0x15a9: 0x4000, + 0x15aa: 0x4000, 0x15ab: 0x4000, 0x15ac: 0x4000, 0x15ad: 0x4000, 0x15ae: 0x4000, 0x15af: 0x4000, + 0x15b0: 0x4000, 0x15b1: 0x4000, 0x15b2: 0x4000, 0x15b3: 0x4000, 0x15b4: 0x4000, 0x15b5: 0x4000, + 0x15b6: 0x4000, 0x15b7: 0x4000, 0x15b8: 0x4000, 0x15b9: 0x4000, 0x15ba: 0x4000, 0x15bb: 0x4000, + 0x15bc: 0x4000, 0x15bd: 0x4000, 0x15be: 0x4000, 0x15bf: 0x4000, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x4000, 0x15c1: 0x4000, 0x15c2: 0x4000, 0x15c3: 0x4000, 0x15c4: 0x4000, 0x15c5: 0x4000, + 0x15c6: 0x4000, 0x15c7: 0x4000, 0x15c8: 0x4000, 0x15c9: 0x4000, 0x15ca: 0x4000, + 0x15cf: 0x4000, 0x15d0: 0x4000, 0x15d1: 0x4000, + 0x15d2: 0x4000, 0x15d3: 0x4000, + 0x15e0: 0x4000, 0x15e1: 0x4000, 0x15e2: 0x4000, 0x15e3: 0x4000, + 0x15e4: 0x4000, 0x15e5: 0x4000, 0x15e6: 0x4000, 0x15e7: 0x4000, 0x15e8: 0x4000, 0x15e9: 0x4000, + 0x15ea: 0x4000, 0x15eb: 0x4000, 0x15ec: 0x4000, 0x15ed: 0x4000, 0x15ee: 0x4000, 0x15ef: 0x4000, + 0x15f0: 0x4000, 0x15f4: 0x4000, + 0x15f8: 0x4000, 0x15f9: 0x4000, 0x15fa: 0x4000, 0x15fb: 0x4000, + 0x15fc: 0x4000, 0x15fd: 0x4000, 0x15fe: 0x4000, 0x15ff: 0x4000, + // Block 0x58, offset 0x1600 + 0x1600: 0x4000, 0x1602: 0x4000, 0x1603: 0x4000, 0x1604: 0x4000, 0x1605: 0x4000, + 0x1606: 0x4000, 0x1607: 0x4000, 0x1608: 0x4000, 0x1609: 0x4000, 0x160a: 0x4000, 0x160b: 0x4000, + 0x160c: 0x4000, 0x160d: 0x4000, 0x160e: 0x4000, 0x160f: 0x4000, 0x1610: 0x4000, 0x1611: 0x4000, + 0x1612: 0x4000, 0x1613: 0x4000, 0x1614: 0x4000, 0x1615: 0x4000, 0x1616: 0x4000, 0x1617: 0x4000, + 0x1618: 0x4000, 0x1619: 0x4000, 0x161a: 0x4000, 0x161b: 0x4000, 0x161c: 0x4000, 0x161d: 0x4000, + 0x161e: 0x4000, 0x161f: 0x4000, 0x1620: 0x4000, 0x1621: 0x4000, 0x1622: 0x4000, 0x1623: 0x4000, + 0x1624: 0x4000, 0x1625: 0x4000, 0x1626: 0x4000, 0x1627: 0x4000, 0x1628: 0x4000, 0x1629: 0x4000, + 0x162a: 0x4000, 0x162b: 0x4000, 0x162c: 0x4000, 0x162d: 0x4000, 0x162e: 0x4000, 0x162f: 0x4000, + 0x1630: 0x4000, 0x1631: 0x4000, 0x1632: 0x4000, 0x1633: 0x4000, 0x1634: 0x4000, 0x1635: 0x4000, + 0x1636: 0x4000, 0x1637: 0x4000, 0x1638: 0x4000, 0x1639: 0x4000, 0x163a: 0x4000, 0x163b: 0x4000, + 0x163c: 0x4000, 0x163d: 0x4000, 0x163e: 0x4000, 0x163f: 0x4000, + // Block 0x59, offset 0x1640 + 0x1640: 0x4000, 0x1641: 0x4000, 0x1642: 0x4000, 0x1643: 0x4000, 0x1644: 0x4000, 0x1645: 0x4000, + 0x1646: 0x4000, 0x1647: 0x4000, 0x1648: 0x4000, 0x1649: 0x4000, 0x164a: 0x4000, 0x164b: 0x4000, + 0x164c: 0x4000, 0x164d: 0x4000, 0x164e: 0x4000, 0x164f: 0x4000, 0x1650: 0x4000, 0x1651: 0x4000, + 0x1652: 0x4000, 0x1653: 0x4000, 0x1654: 0x4000, 0x1655: 0x4000, 0x1656: 0x4000, 0x1657: 0x4000, + 0x1658: 0x4000, 0x1659: 0x4000, 0x165a: 0x4000, 0x165b: 0x4000, 0x165c: 0x4000, 0x165d: 0x4000, + 0x165e: 0x4000, 0x165f: 0x4000, 0x1660: 0x4000, 0x1661: 0x4000, 0x1662: 0x4000, 0x1663: 0x4000, + 0x1664: 0x4000, 0x1665: 0x4000, 0x1666: 0x4000, 0x1667: 0x4000, 0x1668: 0x4000, 0x1669: 0x4000, + 0x166a: 0x4000, 0x166b: 0x4000, 0x166c: 0x4000, 0x166d: 0x4000, 0x166e: 0x4000, 0x166f: 0x4000, + 0x1670: 0x4000, 0x1671: 0x4000, 0x1672: 0x4000, 0x1673: 0x4000, 0x1674: 0x4000, 0x1675: 0x4000, + 0x1676: 0x4000, 0x1677: 0x4000, 0x1678: 0x4000, 0x1679: 0x4000, 0x167a: 0x4000, 0x167b: 0x4000, + 0x167c: 0x4000, 0x167f: 0x4000, + // Block 0x5a, offset 0x1680 + 0x1680: 0x4000, 0x1681: 0x4000, 0x1682: 0x4000, 0x1683: 0x4000, 0x1684: 0x4000, 0x1685: 0x4000, + 0x1686: 0x4000, 0x1687: 0x4000, 0x1688: 0x4000, 0x1689: 0x4000, 0x168a: 0x4000, 0x168b: 0x4000, + 0x168c: 0x4000, 0x168d: 0x4000, 0x168e: 0x4000, 0x168f: 0x4000, 0x1690: 0x4000, 0x1691: 0x4000, + 0x1692: 0x4000, 0x1693: 0x4000, 0x1694: 0x4000, 0x1695: 0x4000, 0x1696: 0x4000, 0x1697: 0x4000, + 0x1698: 0x4000, 0x1699: 0x4000, 0x169a: 0x4000, 0x169b: 0x4000, 0x169c: 0x4000, 0x169d: 0x4000, + 0x169e: 0x4000, 0x169f: 0x4000, 0x16a0: 0x4000, 0x16a1: 0x4000, 0x16a2: 0x4000, 0x16a3: 0x4000, + 0x16a4: 0x4000, 0x16a5: 0x4000, 0x16a6: 0x4000, 0x16a7: 0x4000, 0x16a8: 0x4000, 0x16a9: 0x4000, + 0x16aa: 0x4000, 0x16ab: 0x4000, 0x16ac: 0x4000, 0x16ad: 0x4000, 0x16ae: 0x4000, 0x16af: 0x4000, + 0x16b0: 0x4000, 0x16b1: 0x4000, 0x16b2: 0x4000, 0x16b3: 0x4000, 0x16b4: 0x4000, 0x16b5: 0x4000, + 0x16b6: 0x4000, 0x16b7: 0x4000, 0x16b8: 0x4000, 0x16b9: 0x4000, 0x16ba: 0x4000, 0x16bb: 0x4000, + 0x16bc: 0x4000, 0x16bd: 0x4000, + // Block 0x5b, offset 0x16c0 + 0x16cb: 0x4000, + 0x16cc: 0x4000, 0x16cd: 0x4000, 0x16ce: 0x4000, 0x16d0: 0x4000, 0x16d1: 0x4000, + 0x16d2: 0x4000, 0x16d3: 0x4000, 0x16d4: 0x4000, 0x16d5: 0x4000, 0x16d6: 0x4000, 0x16d7: 0x4000, + 0x16d8: 0x4000, 0x16d9: 0x4000, 0x16da: 0x4000, 0x16db: 0x4000, 0x16dc: 0x4000, 0x16dd: 0x4000, + 0x16de: 0x4000, 0x16df: 0x4000, 0x16e0: 0x4000, 0x16e1: 0x4000, 0x16e2: 0x4000, 0x16e3: 0x4000, + 0x16e4: 0x4000, 0x16e5: 0x4000, 0x16e6: 0x4000, 0x16e7: 0x4000, + 0x16fa: 0x4000, + // Block 0x5c, offset 0x1700 + 0x1715: 0x4000, 0x1716: 0x4000, + 0x1724: 0x4000, + // Block 0x5d, offset 0x1740 + 0x177b: 0x4000, + 0x177c: 0x4000, 0x177d: 0x4000, 0x177e: 0x4000, 0x177f: 0x4000, + // Block 0x5e, offset 0x1780 + 0x1780: 0x4000, 0x1781: 0x4000, 0x1782: 0x4000, 0x1783: 0x4000, 0x1784: 0x4000, 0x1785: 0x4000, + 0x1786: 0x4000, 0x1787: 0x4000, 0x1788: 0x4000, 0x1789: 0x4000, 0x178a: 0x4000, 0x178b: 0x4000, + 0x178c: 0x4000, 0x178d: 0x4000, 0x178e: 0x4000, 0x178f: 0x4000, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x4000, 0x17c1: 0x4000, 0x17c2: 0x4000, 0x17c3: 0x4000, 0x17c4: 0x4000, 0x17c5: 0x4000, + 0x17cc: 0x4000, 0x17d0: 0x4000, 0x17d1: 0x4000, + 0x17d2: 0x4000, + 0x17eb: 0x4000, 0x17ec: 0x4000, + 0x17f4: 0x4000, 0x17f5: 0x4000, + 0x17f6: 0x4000, 0x17f7: 0x4000, 0x17f8: 0x4000, + // Block 0x60, offset 0x1800 + 0x1810: 0x4000, 0x1811: 0x4000, + 0x1812: 0x4000, 0x1813: 0x4000, 0x1814: 0x4000, 0x1815: 0x4000, 0x1816: 0x4000, 0x1817: 0x4000, + 0x1818: 0x4000, 0x1819: 0x4000, 0x181a: 0x4000, 0x181b: 0x4000, 0x181c: 0x4000, 0x181d: 0x4000, + 0x181e: 0x4000, 0x181f: 0x4000, 0x1820: 0x4000, 0x1821: 0x4000, 0x1822: 0x4000, 0x1823: 0x4000, + 0x1824: 0x4000, 0x1825: 0x4000, 0x1826: 0x4000, 0x1827: 0x4000, 0x1828: 0x4000, 0x1829: 0x4000, + 0x182a: 0x4000, 0x182b: 0x4000, 0x182c: 0x4000, 0x182d: 0x4000, 0x182e: 0x4000, 0x182f: 0x4000, + 0x1830: 0x4000, 0x1831: 0x4000, 0x1832: 0x4000, 0x1833: 0x4000, 0x1834: 0x4000, 0x1835: 0x4000, + 0x1836: 0x4000, 0x1837: 0x4000, 0x1838: 0x4000, 0x1839: 0x4000, 0x183a: 0x4000, 0x183b: 0x4000, + 0x183c: 0x4000, 0x183d: 0x4000, 0x183e: 0x4000, + // Block 0x61, offset 0x1840 + 0x1840: 0x4000, 0x1841: 0x4000, 0x1842: 0x4000, 0x1843: 0x4000, 0x1844: 0x4000, 0x1845: 0x4000, + 0x1846: 0x4000, 0x1847: 0x4000, 0x1848: 0x4000, 0x1849: 0x4000, 0x184a: 0x4000, 0x184b: 0x4000, + 0x184c: 0x4000, 0x1850: 0x4000, 0x1851: 0x4000, + 0x1852: 0x4000, 0x1853: 0x4000, 0x1854: 0x4000, 0x1855: 0x4000, 0x1856: 0x4000, 0x1857: 0x4000, + 0x1858: 0x4000, 0x1859: 0x4000, 0x185a: 0x4000, 0x185b: 0x4000, 0x185c: 0x4000, 0x185d: 0x4000, + 0x185e: 0x4000, 0x185f: 0x4000, 0x1860: 0x4000, 0x1861: 0x4000, 0x1862: 0x4000, 0x1863: 0x4000, + 0x1864: 0x4000, 0x1865: 0x4000, 0x1866: 0x4000, 0x1867: 0x4000, 0x1868: 0x4000, 0x1869: 0x4000, + 0x186a: 0x4000, 0x186b: 0x4000, + // Block 0x62, offset 0x1880 + 0x1880: 0x4000, 0x1881: 0x4000, 0x1882: 0x4000, 0x1883: 0x4000, 0x1884: 0x4000, 0x1885: 0x4000, + 0x1886: 0x4000, 0x1887: 0x4000, 0x1888: 0x4000, 0x1889: 0x4000, 0x188a: 0x4000, 0x188b: 0x4000, + 0x188c: 0x4000, 0x188d: 0x4000, 0x188e: 0x4000, 0x188f: 0x4000, 0x1890: 0x4000, 0x1891: 0x4000, + 0x1892: 0x4000, 0x1893: 0x4000, 0x1894: 0x4000, 0x1895: 0x4000, 0x1896: 0x4000, 0x1897: 0x4000, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x4000, + 0x18d0: 0x4000, 0x18d1: 0x4000, + 0x18d2: 0x4000, 0x18d3: 0x4000, 0x18d4: 0x4000, 0x18d5: 0x4000, 0x18d6: 0x4000, 0x18d7: 0x4000, + 0x18d8: 0x4000, 0x18d9: 0x4000, 0x18da: 0x4000, 0x18db: 0x4000, 0x18dc: 0x4000, 0x18dd: 0x4000, + 0x18de: 0x4000, 0x18df: 0x4000, 0x18e0: 0x4000, 0x18e1: 0x4000, 0x18e2: 0x4000, 0x18e3: 0x4000, + 0x18e4: 0x4000, 0x18e5: 0x4000, 0x18e6: 0x4000, + // Block 0x64, offset 0x1900 + 0x1900: 0x2000, 0x1901: 0x2000, 0x1902: 0x2000, 0x1903: 0x2000, 0x1904: 0x2000, 0x1905: 0x2000, + 0x1906: 0x2000, 0x1907: 0x2000, 0x1908: 0x2000, 0x1909: 0x2000, 0x190a: 0x2000, 0x190b: 0x2000, + 0x190c: 0x2000, 0x190d: 0x2000, 0x190e: 0x2000, 0x190f: 0x2000, 0x1910: 0x2000, 0x1911: 0x2000, + 0x1912: 0x2000, 0x1913: 0x2000, 0x1914: 0x2000, 0x1915: 0x2000, 0x1916: 0x2000, 0x1917: 0x2000, + 0x1918: 0x2000, 0x1919: 0x2000, 0x191a: 0x2000, 0x191b: 0x2000, 0x191c: 0x2000, 0x191d: 0x2000, + 0x191e: 0x2000, 0x191f: 0x2000, 0x1920: 0x2000, 0x1921: 0x2000, 0x1922: 0x2000, 0x1923: 0x2000, + 0x1924: 0x2000, 0x1925: 0x2000, 0x1926: 0x2000, 0x1927: 0x2000, 0x1928: 0x2000, 0x1929: 0x2000, + 0x192a: 0x2000, 0x192b: 0x2000, 0x192c: 0x2000, 0x192d: 0x2000, 0x192e: 0x2000, 0x192f: 0x2000, + 0x1930: 0x2000, 0x1931: 0x2000, 0x1932: 0x2000, 0x1933: 0x2000, 0x1934: 0x2000, 0x1935: 0x2000, + 0x1936: 0x2000, 0x1937: 0x2000, 0x1938: 0x2000, 0x1939: 0x2000, 0x193a: 0x2000, 0x193b: 0x2000, + 0x193c: 0x2000, 0x193d: 0x2000, +} + +// widthIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var widthIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc7: 0x05, + 0xc9: 0x06, 0xcb: 0x07, 0xcc: 0x08, 0xcd: 0x09, 0xce: 0x0a, 0xcf: 0x0b, + 0xd0: 0x0c, 0xd1: 0x0d, + 0xe1: 0x02, 0xe2: 0x03, 0xe3: 0x04, 0xe4: 0x05, 0xe5: 0x06, 0xe6: 0x06, 0xe7: 0x06, + 0xe8: 0x06, 0xe9: 0x06, 0xea: 0x07, 0xeb: 0x06, 0xec: 0x06, 0xed: 0x08, 0xee: 0x09, 0xef: 0x0a, + 0xf0: 0x0f, 0xf3: 0x12, 0xf4: 0x13, + // Block 0x4, offset 0x100 + 0x104: 0x0e, 0x105: 0x0f, + // Block 0x5, offset 0x140 + 0x140: 0x10, 0x141: 0x11, 0x142: 0x12, 0x144: 0x13, 0x145: 0x14, 0x146: 0x15, 0x147: 0x16, + 0x148: 0x17, 0x149: 0x18, 0x14a: 0x19, 0x14c: 0x1a, 0x14f: 0x1b, + 0x151: 0x1c, 0x152: 0x08, 0x153: 0x1d, 0x154: 0x1e, 0x155: 0x1f, 0x156: 0x20, 0x157: 0x21, + 0x158: 0x22, 0x159: 0x23, 0x15a: 0x24, 0x15b: 0x25, 0x15c: 0x26, 0x15d: 0x27, 0x15e: 0x28, 0x15f: 0x29, + 0x166: 0x2a, + 0x16c: 0x2b, 0x16d: 0x2c, + 0x17a: 0x2d, 0x17b: 0x2e, 0x17c: 0x0e, 0x17d: 0x0e, 0x17e: 0x0e, 0x17f: 0x2f, + // Block 0x6, offset 0x180 + 0x180: 0x30, 0x181: 0x31, 0x182: 0x32, 0x183: 0x33, 0x184: 0x34, 0x185: 0x35, 0x186: 0x36, 0x187: 0x37, + 0x188: 0x38, 0x189: 0x39, 0x18a: 0x0e, 0x18b: 0x3a, 0x18c: 0x0e, 0x18d: 0x0e, 0x18e: 0x0e, 0x18f: 0x0e, + 0x190: 0x0e, 0x191: 0x0e, 0x192: 0x0e, 0x193: 0x0e, 0x194: 0x0e, 0x195: 0x0e, 0x196: 0x0e, 0x197: 0x0e, + 0x198: 0x0e, 0x199: 0x0e, 0x19a: 0x0e, 0x19b: 0x0e, 0x19c: 0x0e, 0x19d: 0x0e, 0x19e: 0x0e, 0x19f: 0x0e, + 0x1a0: 0x0e, 0x1a1: 0x0e, 0x1a2: 0x0e, 0x1a3: 0x0e, 0x1a4: 0x0e, 0x1a5: 0x0e, 0x1a6: 0x0e, 0x1a7: 0x0e, + 0x1a8: 0x0e, 0x1a9: 0x0e, 0x1aa: 0x0e, 0x1ab: 0x0e, 0x1ac: 0x0e, 0x1ad: 0x0e, 0x1ae: 0x0e, 0x1af: 0x0e, + 0x1b0: 0x0e, 0x1b1: 0x0e, 0x1b2: 0x0e, 0x1b3: 0x0e, 0x1b4: 0x0e, 0x1b5: 0x0e, 0x1b6: 0x0e, 0x1b7: 0x0e, + 0x1b8: 0x0e, 0x1b9: 0x0e, 0x1ba: 0x0e, 0x1bb: 0x0e, 0x1bc: 0x0e, 0x1bd: 0x0e, 0x1be: 0x0e, 0x1bf: 0x0e, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0e, 0x1c1: 0x0e, 0x1c2: 0x0e, 0x1c3: 0x0e, 0x1c4: 0x0e, 0x1c5: 0x0e, 0x1c6: 0x0e, 0x1c7: 0x0e, + 0x1c8: 0x0e, 0x1c9: 0x0e, 0x1ca: 0x0e, 0x1cb: 0x0e, 0x1cc: 0x0e, 0x1cd: 0x0e, 0x1ce: 0x0e, 0x1cf: 0x0e, + 0x1d0: 0x0e, 0x1d1: 0x0e, 0x1d2: 0x0e, 0x1d3: 0x0e, 0x1d4: 0x0e, 0x1d5: 0x0e, 0x1d6: 0x0e, 0x1d7: 0x0e, + 0x1d8: 0x0e, 0x1d9: 0x0e, 0x1da: 0x0e, 0x1db: 0x0e, 0x1dc: 0x0e, 0x1dd: 0x0e, 0x1de: 0x0e, 0x1df: 0x0e, + 0x1e0: 0x0e, 0x1e1: 0x0e, 0x1e2: 0x0e, 0x1e3: 0x0e, 0x1e4: 0x0e, 0x1e5: 0x0e, 0x1e6: 0x0e, 0x1e7: 0x0e, + 0x1e8: 0x0e, 0x1e9: 0x0e, 0x1ea: 0x0e, 0x1eb: 0x0e, 0x1ec: 0x0e, 0x1ed: 0x0e, 0x1ee: 0x0e, 0x1ef: 0x0e, + 0x1f0: 0x0e, 0x1f1: 0x0e, 0x1f2: 0x0e, 0x1f3: 0x0e, 0x1f4: 0x0e, 0x1f5: 0x0e, 0x1f6: 0x0e, + 0x1f8: 0x0e, 0x1f9: 0x0e, 0x1fa: 0x0e, 0x1fb: 0x0e, 0x1fc: 0x0e, 0x1fd: 0x0e, 0x1fe: 0x0e, 0x1ff: 0x0e, + // Block 0x8, offset 0x200 + 0x200: 0x0e, 0x201: 0x0e, 0x202: 0x0e, 0x203: 0x0e, 0x204: 0x0e, 0x205: 0x0e, 0x206: 0x0e, 0x207: 0x0e, + 0x208: 0x0e, 0x209: 0x0e, 0x20a: 0x0e, 0x20b: 0x0e, 0x20c: 0x0e, 0x20d: 0x0e, 0x20e: 0x0e, 0x20f: 0x0e, + 0x210: 0x0e, 0x211: 0x0e, 0x212: 0x0e, 0x213: 0x0e, 0x214: 0x0e, 0x215: 0x0e, 0x216: 0x0e, 0x217: 0x0e, + 0x218: 0x0e, 0x219: 0x0e, 0x21a: 0x0e, 0x21b: 0x0e, 0x21c: 0x0e, 0x21d: 0x0e, 0x21e: 0x0e, 0x21f: 0x0e, + 0x220: 0x0e, 0x221: 0x0e, 0x222: 0x0e, 0x223: 0x0e, 0x224: 0x0e, 0x225: 0x0e, 0x226: 0x0e, 0x227: 0x0e, + 0x228: 0x0e, 0x229: 0x0e, 0x22a: 0x0e, 0x22b: 0x0e, 0x22c: 0x0e, 0x22d: 0x0e, 0x22e: 0x0e, 0x22f: 0x0e, + 0x230: 0x0e, 0x231: 0x0e, 0x232: 0x0e, 0x233: 0x0e, 0x234: 0x0e, 0x235: 0x0e, 0x236: 0x0e, 0x237: 0x0e, + 0x238: 0x0e, 0x239: 0x0e, 0x23a: 0x0e, 0x23b: 0x0e, 0x23c: 0x0e, 0x23d: 0x0e, 0x23e: 0x0e, 0x23f: 0x0e, + // Block 0x9, offset 0x240 + 0x240: 0x0e, 0x241: 0x0e, 0x242: 0x0e, 0x243: 0x0e, 0x244: 0x0e, 0x245: 0x0e, 0x246: 0x0e, 0x247: 0x0e, + 0x248: 0x0e, 0x249: 0x0e, 0x24a: 0x0e, 0x24b: 0x0e, 0x24c: 0x0e, 0x24d: 0x0e, 0x24e: 0x0e, 0x24f: 0x0e, + 0x250: 0x0e, 0x251: 0x0e, 0x252: 0x3b, 0x253: 0x3c, + 0x265: 0x3d, + 0x270: 0x0e, 0x271: 0x0e, 0x272: 0x0e, 0x273: 0x0e, 0x274: 0x0e, 0x275: 0x0e, 0x276: 0x0e, 0x277: 0x0e, + 0x278: 0x0e, 0x279: 0x0e, 0x27a: 0x0e, 0x27b: 0x0e, 0x27c: 0x0e, 0x27d: 0x0e, 0x27e: 0x0e, 0x27f: 0x0e, + // Block 0xa, offset 0x280 + 0x280: 0x0e, 0x281: 0x0e, 0x282: 0x0e, 0x283: 0x0e, 0x284: 0x0e, 0x285: 0x0e, 0x286: 0x0e, 0x287: 0x0e, + 0x288: 0x0e, 0x289: 0x0e, 0x28a: 0x0e, 0x28b: 0x0e, 0x28c: 0x0e, 0x28d: 0x0e, 0x28e: 0x0e, 0x28f: 0x0e, + 0x290: 0x0e, 0x291: 0x0e, 0x292: 0x0e, 0x293: 0x0e, 0x294: 0x0e, 0x295: 0x0e, 0x296: 0x0e, 0x297: 0x0e, + 0x298: 0x0e, 0x299: 0x0e, 0x29a: 0x0e, 0x29b: 0x0e, 0x29c: 0x0e, 0x29d: 0x0e, 0x29e: 0x3e, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x08, 0x2c1: 0x08, 0x2c2: 0x08, 0x2c3: 0x08, 0x2c4: 0x08, 0x2c5: 0x08, 0x2c6: 0x08, 0x2c7: 0x08, + 0x2c8: 0x08, 0x2c9: 0x08, 0x2ca: 0x08, 0x2cb: 0x08, 0x2cc: 0x08, 0x2cd: 0x08, 0x2ce: 0x08, 0x2cf: 0x08, + 0x2d0: 0x08, 0x2d1: 0x08, 0x2d2: 0x08, 0x2d3: 0x08, 0x2d4: 0x08, 0x2d5: 0x08, 0x2d6: 0x08, 0x2d7: 0x08, + 0x2d8: 0x08, 0x2d9: 0x08, 0x2da: 0x08, 0x2db: 0x08, 0x2dc: 0x08, 0x2dd: 0x08, 0x2de: 0x08, 0x2df: 0x08, + 0x2e0: 0x08, 0x2e1: 0x08, 0x2e2: 0x08, 0x2e3: 0x08, 0x2e4: 0x08, 0x2e5: 0x08, 0x2e6: 0x08, 0x2e7: 0x08, + 0x2e8: 0x08, 0x2e9: 0x08, 0x2ea: 0x08, 0x2eb: 0x08, 0x2ec: 0x08, 0x2ed: 0x08, 0x2ee: 0x08, 0x2ef: 0x08, + 0x2f0: 0x08, 0x2f1: 0x08, 0x2f2: 0x08, 0x2f3: 0x08, 0x2f4: 0x08, 0x2f5: 0x08, 0x2f6: 0x08, 0x2f7: 0x08, + 0x2f8: 0x08, 0x2f9: 0x08, 0x2fa: 0x08, 0x2fb: 0x08, 0x2fc: 0x08, 0x2fd: 0x08, 0x2fe: 0x08, 0x2ff: 0x08, + // Block 0xc, offset 0x300 + 0x300: 0x08, 0x301: 0x08, 0x302: 0x08, 0x303: 0x08, 0x304: 0x08, 0x305: 0x08, 0x306: 0x08, 0x307: 0x08, + 0x308: 0x08, 0x309: 0x08, 0x30a: 0x08, 0x30b: 0x08, 0x30c: 0x08, 0x30d: 0x08, 0x30e: 0x08, 0x30f: 0x08, + 0x310: 0x08, 0x311: 0x08, 0x312: 0x08, 0x313: 0x08, 0x314: 0x08, 0x315: 0x08, 0x316: 0x08, 0x317: 0x08, + 0x318: 0x08, 0x319: 0x08, 0x31a: 0x08, 0x31b: 0x08, 0x31c: 0x08, 0x31d: 0x08, 0x31e: 0x08, 0x31f: 0x08, + 0x320: 0x08, 0x321: 0x08, 0x322: 0x08, 0x323: 0x08, 0x324: 0x0e, 0x325: 0x0e, 0x326: 0x0e, 0x327: 0x0e, + 0x328: 0x0e, 0x329: 0x0e, 0x32a: 0x0e, 0x32b: 0x0e, + 0x338: 0x3f, 0x339: 0x40, 0x33c: 0x41, 0x33d: 0x42, 0x33e: 0x43, 0x33f: 0x44, + // Block 0xd, offset 0x340 + 0x37f: 0x45, + // Block 0xe, offset 0x380 + 0x380: 0x0e, 0x381: 0x0e, 0x382: 0x0e, 0x383: 0x0e, 0x384: 0x0e, 0x385: 0x0e, 0x386: 0x0e, 0x387: 0x0e, + 0x388: 0x0e, 0x389: 0x0e, 0x38a: 0x0e, 0x38b: 0x0e, 0x38c: 0x0e, 0x38d: 0x0e, 0x38e: 0x0e, 0x38f: 0x0e, + 0x390: 0x0e, 0x391: 0x0e, 0x392: 0x0e, 0x393: 0x0e, 0x394: 0x0e, 0x395: 0x0e, 0x396: 0x0e, 0x397: 0x0e, + 0x398: 0x0e, 0x399: 0x0e, 0x39a: 0x0e, 0x39b: 0x0e, 0x39c: 0x0e, 0x39d: 0x0e, 0x39e: 0x0e, 0x39f: 0x46, + 0x3a0: 0x0e, 0x3a1: 0x0e, 0x3a2: 0x0e, 0x3a3: 0x0e, 0x3a4: 0x0e, 0x3a5: 0x0e, 0x3a6: 0x0e, 0x3a7: 0x0e, + 0x3a8: 0x0e, 0x3a9: 0x0e, 0x3aa: 0x0e, 0x3ab: 0x47, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0e, 0x3c1: 0x0e, 0x3c2: 0x0e, 0x3c3: 0x0e, 0x3c4: 0x48, 0x3c5: 0x49, 0x3c6: 0x0e, 0x3c7: 0x0e, + 0x3c8: 0x0e, 0x3c9: 0x0e, 0x3ca: 0x0e, 0x3cb: 0x4a, + // Block 0x10, offset 0x400 + 0x400: 0x4b, 0x403: 0x4c, 0x404: 0x4d, 0x405: 0x4e, 0x406: 0x4f, + 0x408: 0x50, 0x409: 0x51, 0x40c: 0x52, 0x40d: 0x53, 0x40e: 0x54, 0x40f: 0x55, + 0x410: 0x3a, 0x411: 0x56, 0x412: 0x0e, 0x413: 0x57, 0x414: 0x58, 0x415: 0x59, 0x416: 0x5a, 0x417: 0x5b, + 0x418: 0x0e, 0x419: 0x5c, 0x41a: 0x0e, 0x41b: 0x5d, + 0x424: 0x5e, 0x425: 0x5f, 0x426: 0x60, 0x427: 0x61, + // Block 0x11, offset 0x440 + 0x456: 0x0b, 0x457: 0x06, + 0x458: 0x0c, 0x45b: 0x0d, 0x45f: 0x0e, + 0x460: 0x06, 0x461: 0x06, 0x462: 0x06, 0x463: 0x06, 0x464: 0x06, 0x465: 0x06, 0x466: 0x06, 0x467: 0x06, + 0x468: 0x06, 0x469: 0x06, 0x46a: 0x06, 0x46b: 0x06, 0x46c: 0x06, 0x46d: 0x06, 0x46e: 0x06, 0x46f: 0x06, + 0x470: 0x06, 0x471: 0x06, 0x472: 0x06, 0x473: 0x06, 0x474: 0x06, 0x475: 0x06, 0x476: 0x06, 0x477: 0x06, + 0x478: 0x06, 0x479: 0x06, 0x47a: 0x06, 0x47b: 0x06, 0x47c: 0x06, 0x47d: 0x06, 0x47e: 0x06, 0x47f: 0x06, + // Block 0x12, offset 0x480 + 0x484: 0x08, 0x485: 0x08, 0x486: 0x08, 0x487: 0x09, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x08, 0x4c1: 0x08, 0x4c2: 0x08, 0x4c3: 0x08, 0x4c4: 0x08, 0x4c5: 0x08, 0x4c6: 0x08, 0x4c7: 0x08, + 0x4c8: 0x08, 0x4c9: 0x08, 0x4ca: 0x08, 0x4cb: 0x08, 0x4cc: 0x08, 0x4cd: 0x08, 0x4ce: 0x08, 0x4cf: 0x08, + 0x4d0: 0x08, 0x4d1: 0x08, 0x4d2: 0x08, 0x4d3: 0x08, 0x4d4: 0x08, 0x4d5: 0x08, 0x4d6: 0x08, 0x4d7: 0x08, + 0x4d8: 0x08, 0x4d9: 0x08, 0x4da: 0x08, 0x4db: 0x08, 0x4dc: 0x08, 0x4dd: 0x08, 0x4de: 0x08, 0x4df: 0x08, + 0x4e0: 0x08, 0x4e1: 0x08, 0x4e2: 0x08, 0x4e3: 0x08, 0x4e4: 0x08, 0x4e5: 0x08, 0x4e6: 0x08, 0x4e7: 0x08, + 0x4e8: 0x08, 0x4e9: 0x08, 0x4ea: 0x08, 0x4eb: 0x08, 0x4ec: 0x08, 0x4ed: 0x08, 0x4ee: 0x08, 0x4ef: 0x08, + 0x4f0: 0x08, 0x4f1: 0x08, 0x4f2: 0x08, 0x4f3: 0x08, 0x4f4: 0x08, 0x4f5: 0x08, 0x4f6: 0x08, 0x4f7: 0x08, + 0x4f8: 0x08, 0x4f9: 0x08, 0x4fa: 0x08, 0x4fb: 0x08, 0x4fc: 0x08, 0x4fd: 0x08, 0x4fe: 0x08, 0x4ff: 0x62, + // Block 0x14, offset 0x500 + 0x520: 0x10, + 0x530: 0x09, 0x531: 0x09, 0x532: 0x09, 0x533: 0x09, 0x534: 0x09, 0x535: 0x09, 0x536: 0x09, 0x537: 0x09, + 0x538: 0x09, 0x539: 0x09, 0x53a: 0x09, 0x53b: 0x09, 0x53c: 0x09, 0x53d: 0x09, 0x53e: 0x09, 0x53f: 0x11, + // Block 0x15, offset 0x540 + 0x540: 0x09, 0x541: 0x09, 0x542: 0x09, 0x543: 0x09, 0x544: 0x09, 0x545: 0x09, 0x546: 0x09, 0x547: 0x09, + 0x548: 0x09, 0x549: 0x09, 0x54a: 0x09, 0x54b: 0x09, 0x54c: 0x09, 0x54d: 0x09, 0x54e: 0x09, 0x54f: 0x11, +} + +// inverseData contains 4-byte entries of the following format: +// <0 padding> +// The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the +// UTF-8 encoding of the original rune. Mappings often have the following +// pattern: +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// By xor-ing the last byte the same entry can be shared by many mappings. This +// reduces the total number of distinct entries by about two thirds. +// The resulting entry for the aforementioned mappings is +// { 0x01, 0xE0, 0x00, 0x00 } +// Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get +// E0 ^ A1 = 41. +// Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get +// E0 ^ A2 = 42. +// Note that because of the xor-ing, the byte sequence stored in the entry is +// not valid UTF-8. +var inverseData = [150][4]byte{ + {0x00, 0x00, 0x00, 0x00}, + {0x03, 0xe3, 0x80, 0xa0}, + {0x03, 0xef, 0xbc, 0xa0}, + {0x03, 0xef, 0xbc, 0xe0}, + {0x03, 0xef, 0xbd, 0xe0}, + {0x03, 0xef, 0xbf, 0x02}, + {0x03, 0xef, 0xbf, 0x00}, + {0x03, 0xef, 0xbf, 0x0e}, + {0x03, 0xef, 0xbf, 0x0c}, + {0x03, 0xef, 0xbf, 0x0f}, + {0x03, 0xef, 0xbf, 0x39}, + {0x03, 0xef, 0xbf, 0x3b}, + {0x03, 0xef, 0xbf, 0x3f}, + {0x03, 0xef, 0xbf, 0x2a}, + {0x03, 0xef, 0xbf, 0x0d}, + {0x03, 0xef, 0xbf, 0x25}, + {0x03, 0xef, 0xbd, 0x1a}, + {0x03, 0xef, 0xbd, 0x26}, + {0x01, 0xa0, 0x00, 0x00}, + {0x03, 0xef, 0xbd, 0x25}, + {0x03, 0xef, 0xbd, 0x23}, + {0x03, 0xef, 0xbd, 0x2e}, + {0x03, 0xef, 0xbe, 0x07}, + {0x03, 0xef, 0xbe, 0x05}, + {0x03, 0xef, 0xbd, 0x06}, + {0x03, 0xef, 0xbd, 0x13}, + {0x03, 0xef, 0xbd, 0x0b}, + {0x03, 0xef, 0xbd, 0x16}, + {0x03, 0xef, 0xbd, 0x0c}, + {0x03, 0xef, 0xbd, 0x15}, + {0x03, 0xef, 0xbd, 0x0d}, + {0x03, 0xef, 0xbd, 0x1c}, + {0x03, 0xef, 0xbd, 0x02}, + {0x03, 0xef, 0xbd, 0x1f}, + {0x03, 0xef, 0xbd, 0x1d}, + {0x03, 0xef, 0xbd, 0x17}, + {0x03, 0xef, 0xbd, 0x08}, + {0x03, 0xef, 0xbd, 0x09}, + {0x03, 0xef, 0xbd, 0x0e}, + {0x03, 0xef, 0xbd, 0x04}, + {0x03, 0xef, 0xbd, 0x05}, + {0x03, 0xef, 0xbe, 0x3f}, + {0x03, 0xef, 0xbe, 0x00}, + {0x03, 0xef, 0xbd, 0x2c}, + {0x03, 0xef, 0xbe, 0x06}, + {0x03, 0xef, 0xbe, 0x0c}, + {0x03, 0xef, 0xbe, 0x0f}, + {0x03, 0xef, 0xbe, 0x0d}, + {0x03, 0xef, 0xbe, 0x0b}, + {0x03, 0xef, 0xbe, 0x19}, + {0x03, 0xef, 0xbe, 0x15}, + {0x03, 0xef, 0xbe, 0x11}, + {0x03, 0xef, 0xbe, 0x31}, + {0x03, 0xef, 0xbe, 0x33}, + {0x03, 0xef, 0xbd, 0x0f}, + {0x03, 0xef, 0xbe, 0x30}, + {0x03, 0xef, 0xbe, 0x3e}, + {0x03, 0xef, 0xbe, 0x32}, + {0x03, 0xef, 0xbe, 0x36}, + {0x03, 0xef, 0xbd, 0x14}, + {0x03, 0xef, 0xbe, 0x2e}, + {0x03, 0xef, 0xbd, 0x1e}, + {0x03, 0xef, 0xbe, 0x10}, + {0x03, 0xef, 0xbf, 0x13}, + {0x03, 0xef, 0xbf, 0x15}, + {0x03, 0xef, 0xbf, 0x17}, + {0x03, 0xef, 0xbf, 0x1f}, + {0x03, 0xef, 0xbf, 0x1d}, + {0x03, 0xef, 0xbf, 0x1b}, + {0x03, 0xef, 0xbf, 0x09}, + {0x03, 0xef, 0xbf, 0x0b}, + {0x03, 0xef, 0xbf, 0x37}, + {0x03, 0xef, 0xbe, 0x04}, + {0x01, 0xe0, 0x00, 0x00}, + {0x03, 0xe2, 0xa6, 0x1a}, + {0x03, 0xe2, 0xa6, 0x26}, + {0x03, 0xe3, 0x80, 0x23}, + {0x03, 0xe3, 0x80, 0x2e}, + {0x03, 0xe3, 0x80, 0x25}, + {0x03, 0xe3, 0x83, 0x1e}, + {0x03, 0xe3, 0x83, 0x14}, + {0x03, 0xe3, 0x82, 0x06}, + {0x03, 0xe3, 0x82, 0x0b}, + {0x03, 0xe3, 0x82, 0x0c}, + {0x03, 0xe3, 0x82, 0x0d}, + {0x03, 0xe3, 0x82, 0x02}, + {0x03, 0xe3, 0x83, 0x0f}, + {0x03, 0xe3, 0x83, 0x08}, + {0x03, 0xe3, 0x83, 0x09}, + {0x03, 0xe3, 0x83, 0x2c}, + {0x03, 0xe3, 0x83, 0x0c}, + {0x03, 0xe3, 0x82, 0x13}, + {0x03, 0xe3, 0x82, 0x16}, + {0x03, 0xe3, 0x82, 0x15}, + {0x03, 0xe3, 0x82, 0x1c}, + {0x03, 0xe3, 0x82, 0x1f}, + {0x03, 0xe3, 0x82, 0x1d}, + {0x03, 0xe3, 0x82, 0x1a}, + {0x03, 0xe3, 0x82, 0x17}, + {0x03, 0xe3, 0x82, 0x08}, + {0x03, 0xe3, 0x82, 0x09}, + {0x03, 0xe3, 0x82, 0x0e}, + {0x03, 0xe3, 0x82, 0x04}, + {0x03, 0xe3, 0x82, 0x05}, + {0x03, 0xe3, 0x82, 0x3f}, + {0x03, 0xe3, 0x83, 0x00}, + {0x03, 0xe3, 0x83, 0x06}, + {0x03, 0xe3, 0x83, 0x05}, + {0x03, 0xe3, 0x83, 0x0d}, + {0x03, 0xe3, 0x83, 0x0b}, + {0x03, 0xe3, 0x83, 0x07}, + {0x03, 0xe3, 0x83, 0x19}, + {0x03, 0xe3, 0x83, 0x15}, + {0x03, 0xe3, 0x83, 0x11}, + {0x03, 0xe3, 0x83, 0x31}, + {0x03, 0xe3, 0x83, 0x33}, + {0x03, 0xe3, 0x83, 0x30}, + {0x03, 0xe3, 0x83, 0x3e}, + {0x03, 0xe3, 0x83, 0x32}, + {0x03, 0xe3, 0x83, 0x36}, + {0x03, 0xe3, 0x83, 0x2e}, + {0x03, 0xe3, 0x82, 0x07}, + {0x03, 0xe3, 0x85, 0x04}, + {0x03, 0xe3, 0x84, 0x10}, + {0x03, 0xe3, 0x85, 0x30}, + {0x03, 0xe3, 0x85, 0x0d}, + {0x03, 0xe3, 0x85, 0x13}, + {0x03, 0xe3, 0x85, 0x15}, + {0x03, 0xe3, 0x85, 0x17}, + {0x03, 0xe3, 0x85, 0x1f}, + {0x03, 0xe3, 0x85, 0x1d}, + {0x03, 0xe3, 0x85, 0x1b}, + {0x03, 0xe3, 0x85, 0x09}, + {0x03, 0xe3, 0x85, 0x0f}, + {0x03, 0xe3, 0x85, 0x0b}, + {0x03, 0xe3, 0x85, 0x37}, + {0x03, 0xe3, 0x85, 0x3b}, + {0x03, 0xe3, 0x85, 0x39}, + {0x03, 0xe3, 0x85, 0x3f}, + {0x02, 0xc2, 0x02, 0x00}, + {0x02, 0xc2, 0x0e, 0x00}, + {0x02, 0xc2, 0x0c, 0x00}, + {0x02, 0xc2, 0x00, 0x00}, + {0x03, 0xe2, 0x82, 0x0f}, + {0x03, 0xe2, 0x94, 0x2a}, + {0x03, 0xe2, 0x86, 0x39}, + {0x03, 0xe2, 0x86, 0x3b}, + {0x03, 0xe2, 0x86, 0x3f}, + {0x03, 0xe2, 0x96, 0x0d}, + {0x03, 0xe2, 0x97, 0x25}, +} + +// Total table size 14936 bytes (14KiB) diff --git a/vendor/golang.org/x/text/width/tables.go b/vendor/golang.org/x/text/width/tables9.0.0.go similarity index 99% rename from vendor/golang.org/x/text/width/tables.go rename to vendor/golang.org/x/text/width/tables9.0.0.go index e21f0b8385..7069e26345 100644 --- a/vendor/golang.org/x/text/width/tables.go +++ b/vendor/golang.org/x/text/width/tables9.0.0.go @@ -1,5 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. +// +build !go1.10 + package width // UnicodeVersion is the Unicode version from which the tables in this package are derived. diff --git a/vendor/golang.org/x/text/width/width.go b/vendor/golang.org/x/text/width/width.go index f1639ca68a..29c7509be7 100644 --- a/vendor/golang.org/x/text/width/width.go +++ b/vendor/golang.org/x/text/width/width.go @@ -12,7 +12,7 @@ // are kept together in words or runs that are rotated sideways in vertical text // layout. // -// For more information, see http://unicode.org/reports/tr11/. +// For more information, see https://unicode.org/reports/tr11/. package width // import "golang.org/x/text/width" import ( @@ -27,7 +27,7 @@ import ( // (approximation, fixed pitch only). // 3) Implement display length. -// Kind indicates the type of width property as defined in http://unicode.org/reports/tr11/. +// Kind indicates the type of width property as defined in https://unicode.org/reports/tr11/. type Kind int const ( @@ -106,7 +106,7 @@ func (e elem) kind() Kind { } // Kind returns the Kind of a rune as defined in Unicode TR #11. -// See http://unicode.org/reports/tr11/ for more details. +// See https://unicode.org/reports/tr11/ for more details. func (p Properties) Kind() Kind { return p.elem.kind() } diff --git a/vendor/modules.txt b/vendor/modules.txt index c66590e059..f17187e6c6 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -958,7 +958,7 @@ golang.org/x/sys/unix golang.org/x/sys/windows golang.org/x/sys/windows/registry golang.org/x/sys/windows/svc -# golang.org/x/text v0.3.0 => golang.org/x/text v0.0.0-20170810154203-b19bf474d317 +# golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db => golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/text/encoding golang.org/x/text/encoding/charmap golang.org/x/text/encoding/htmlindex @@ -969,6 +969,8 @@ golang.org/x/text/encoding/korean golang.org/x/text/encoding/simplifiedchinese golang.org/x/text/encoding/traditionalchinese golang.org/x/text/encoding/unicode +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact golang.org/x/text/internal/tag golang.org/x/text/internal/utf8internal golang.org/x/text/language